KEGG   Neurospora crassa: NCU00213Help
Entry
NCU00213          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ncr  Neurospora crassa
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    NCU00213
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    NCU00213
   04113 Meiosis - yeast
    NCU00213
Protein phosphatases and associated proteins [BR:ncr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     NCU00213
Ubiquitin system [BR:ncr04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     NCU00213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 820 aa AA seqDB search
MAGKMTPNNVTVSLLLRQAIYYHLDNCAYESALFFAERLYAHDQSFCDSAYLLAYTHLRL
GDARTAYHVSRGSGYRGSHLGSCYVFAQACLELERYRDGITGLENGRKQWSKADNLGKHT
SFTRMPYPDAAAFSCLLGRLYRAYDDKKKAIPCFEEALRRNPFMWEAFTNLYDMGVSVRV
PNVFRASDGLAQTLEHGLNATPILAWIAGPSPQPPEPLQLKKTGQQQNRQPSDPFGPYGT
SQESASYPDSENGFISKMYLSQSGITSSQPGKPLEETDTQSAPAPTAHNPQVTRAVHQAE
PPQAPPRRTRAAQATDSTVTDAPPRTGHRLGTRRKDKAQESAKDHAESGTKTSTVSSSIT
ERKRTAAGHPVQTRSMNNEEPRRSARLNVVPRPTATKTTSAGATRELRKARPPISRFARP
GSSGANVGRVISGSRKPPQEDIGMDIDHAEAVPRTKEPPVLQAAPPPPPAPKPAESEFVK
AVEEALKTIFDLLKKLASGYALSSQFQCQEAVAAYMSLPRSHQDTPWVLAQMGRTQYEQA
NYAEAEKYFKRLRVIAPTRLEDMEVYSTVLWHLKKETELSFLAHEMIDSVWDSPEAWCAL
GNAWSLAYDHEQALRCFKRATQLDPKFAYAYTLQGHEHVENEEYDKALTAYRHAIAADKR
HYNAYYGIGRVYEKLGNYDKALSHYHAASVIHPAHAVLICCIGSVLHRQKQFKQALPYFT
KATELAPRAPDVRLKKARALLQMGQLKAAQTELMILKDLAPDRAQVHFLLGKLSKTLHDK
KSAVRHFTIALSLDPKASLQIKEAIESLEDDEGPDDSMMQ
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaagatgacgccaaataatgttaccgtctcccttttgctaaggcaggccatc
tactaccatctcgacaattgtgcctacgagagcgcacttttctttgccgagcgactctat
gcccacgaccaatccttttgcgattccgcctatctcctcgcctacacccatctgcgactc
ggcgacgctcgaaccgcctaccatgtcagtcggggctcgggatatagaggttcgcattta
gggtcctgctacgtcttcgctcaggcgtgcttggagttggagcgatacagagacggaatc
acgggcttggagaatgggaggaaacaatggtccaaggcggacaacttggggaaacatacc
tcttttaccaggatgccatatcccgatgcggctgcctttagctgtctcctgggcagactt
taccgagcatatgacgataagaaaaaggccataccatgttttgaagaggccctacgacga
aatccgttcatgtgggaggctttcacaaacctatacgacatgggagtgagcgtcagagtg
ccgaatgttttcagagcgagcgatggtcttgcgcaaaccctcgagcatggcctcaacgct
acgccgattcttgcttggattgcaggtccttctccgcaaccaccagagcccttgcagcta
aagaagaccggccagcaacaaaacagacagccaagcgatccattcgggccatatgggaca
tcccaggaatcggcgtcatatccagactcggaaaatggctttatatccaagatgtatctt
tctcagtcaggcattacatcaagtcagccagggaaaccgcttgaggaaaccgatacgcaa
tctgcgcctgctccaaccgcccataatcctcaggtcactcgtgctgtacaccaggcagag
ccgccgcaagcgccacctcggagaactcgggcggcccaggcaacagactctactgtaact
gatgcaccacccagaacgggacaccgtctgggaacaagaagaaaagataaagctcaagaa
tcagcgaaagaccatgcggaatcaggtaccaaaacatcaacggtttccagctcaattact
gaaagaaaacgcacggcagcagggcatccagtccaaacaagatcgatgaacaatgaggaa
cctaggcgaagtgcaagacttaatgtagttccaagaccaacggcaacgaaaacaacgagc
gcgggagcaacccgtgagctgaggaaggctaggcccccaatatctcgatttgctcggccg
ggctctagtggagcaaacgttggtcgagttatcagtggcagccggaagccgccacaggag
gatattggtatggacattgaccacgccgaggcagtaccacgcaccaaggagccgccggtg
ctgcaggcggcaccacctccaccccccgcccctaaaccagcggagtctgagtttgtcaag
gcggttgaagaagctttgaaaacaatatttgatttgttgaagaagttggcatccggttat
gcgctttcatcccagttccaatgccaggaggcagtggcggcgtacatgtcacttccgagg
agtcaccaggacacaccctgggttttggcacagatgggaaggactcaatatgaacaggcc
aactatgccgaggcagagaaatacttcaagcgacttcgcgttattgctccgactcgcctt
gaggacatggaggtctactcgactgttctgtggcatttgaagaaagagacggagctctca
ttccttgcccatgagatgatcgactcagtatgggattcaccagaagcatggtgtgccctt
ggaaacgcatggtcgttggcatatgatcatgagcaagccctgaggtgtttcaagcgagcg
acgcaactggatcccaagtttgcgtacgcctacaccctacaaggacacgagcatgtagaa
aacgaggaatacgacaaagccctcacggcctaccgacacgccatagcggcagacaagcgc
cactacaatgcatactacggcatcggaagggtctacgagaagctgggtaactatgacaag
gcactgagccattatcacgctgcctcggtgatccatccggcccatgcggttttaatctgc
tgcataggctcggtcttgcacaggcagaaacagttcaaacaggccctaccgtacttcacc
aaagcgaccgaactggctccacgtgcccctgatgtccggctaaagaaggctcgtgccctt
ttgcagatgggacagttaaaggcggcgcagacagaactcatgattctgaaggacttggct
ccagacagggctcaggtgcacttccttttgggcaagctctccaagacactgcacgataag
aaatcggcggtgcgccactttaccattgctttgagcttagatccaaaggcgagccttcaa
atcaaggaagccattgagagcttggaggacgacgaaggaccggacgattccatgatgcag
tga

DBGET integrated database retrieval system