KEGG   Neurospora crassa: NCU00216Help
Entry
NCU00216          CDS       T01034                                 

Definition
nitrate reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ncr  Neurospora crassa
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NCU00216
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     NCU00216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 310 aa AA seqDB search
MSEESLLERKYFDGIYIPAGLLVFGTVIVKKEWTLYAALAALILGAIKYFRMLPKKVLKP
AVFQEFELKEKTIISHNVAIYRFKLPTPDSVLGLPIGQHISIGAAIEQPDGSTKEIVRSY
TPISGDHQPGYFDLLIKSYPTGNISKHMASLQVGQTIRVKGPKGAFVYTPNMVRHFGMVA
GGTGITPMLQVIRAIVRGRAAGDRTEVDLIFANVTAQDILLKEDLDALVAQDKGIRVHYV
LDRPPEGWTGGVGFVTQEMVEKLLPKPASDVKILLCGPPPMISGLKKATEALGFQKARPV
SKLEDQVFAF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggaatcgctgctcgagcgcaagtactttgacgggatctacatccccgctggc
cttttggtcttcggcaccgtcatcgtcaagaaggaatggactctctacgccgcccttgcg
gccctcatcttgggtgccatcaagtattttaggatgctccccaagaaggttctcaagccc
gctgtcttccaggagttcgagctcaaggagaagaccatcatctcccacaacgtcgccatc
taccgcttcaagctccccactcccgactccgtcctcggcctgcccatcggccaacacatc
tccatcggcgccgccatcgagcaacccgacggctccaccaaggagattgtgcgttcctac
accccgatctcgggcgaccatcaacccggctacttcgacctgctcatcaagtcctacccg
accggcaacatctccaagcacatggcctcgctgcaagtcggccagaccatccgcgtcaag
ggtcccaagggcgcctttgtgtacacccccaacatggtccgtcactttggcatggtcgcc
ggcggtaccggcatcacgcccatgctgcaagtcatccgcgccattgtccggggccgcgcc
gcgggcgaccgcaccgaggtcgatctcattttcgccaacgttactgcgcaggacattctc
ttgaaggaagacctggatgcgctggtggctcaggacaagggtatcagggtccactacgtc
ctcgatcgcccgcctgagggctggaccggtggtgtcggctttgtcacgcaagagatggtg
gagaagctgctgcccaagccggcgagtgatgtcaagattctgctgtgcggccctcccccg
atgattagtgggttgaagaaggcgacggaggcgttgggcttccagaaggctaggccggtt
agcaagttggaggatcaggtgtttgctttctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system