KEGG   Neurospora crassa: NCU00230Help
Entry
NCU00230          CDS       T01034                                 

Gene name
prk-4
Definition
(RefSeq) protein kinase-4
  KO
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     NCU00230 (prk-4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Linkage Group III; III
AA seq 732 aa AA seqDB search
MSTPITATATLPRAYSDRYHSQFAYQHHHQPYPVQANASSFYSQNTSNLPSILSPTGTRQ
PFPDPPSAQYSLVDHQSPVNAPPPLIASSVVLKPITRTLPPPHQCPSQQLPPQRLTLQPG
IDHTAMATGLNPEGSEPASQQTRKRRRGETNWAEFYQNGLPKEVIVIDDTPEPEGTATRS
VASQTLSNAHIVTNPSAPTQPTAKRRRPNGHYDPVHHDNYVPAQNQTQRSLPSASHSLNS
PASTSNSANSAQHTTTATSLGSLSSHSYNDDYAQPGTKRRKLTRQQANEAKRRETAHADT
FAVYKPPPYPPKKAGEVHVKVIQDTSPNQNARVDDDDGHMIVIPGNDLTERYEILKLLGQ
GTFGKVVQAKDKKRNKLVAIKIIRSVQKYRDASKIELRVLATLKANDEENRNRCIHLRDC
FDFRGHICIVMDLLGQSVFDFLKDNNFVPFPNSQILAFARQLFTSVAFLHDLNLIHTDLK
PENILLCNQEYQTFTYSRTIPSSSTLTNRRAVHRKVLLDTEIRLIDFGSATFQDEYHSSV
VSTRHYRAPEIILGLGWSFPCDIWSIGCILVEFYTGDALFQTHDNLEHLAMMEAVVNHKI
DPSLVQQVNRMTRNGGNPAAKFFKRSKLDYPAPDTTRASKRFVKGMKPLDEIIPARNSRF
LALFLDLLKKIFMYDPNKRITARQALEHEWFREHLPPDDGTEATRIRLEKEAERQRREVE
ARRTMLPAMHAA
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcccataaccgccacagcaacgctgcctcgcgcctattcggaccggtaccat
tcgcagtttgcataccagcatcatcatcagccttatcccgtccaggccaacgcctcctcg
ttttattcccagaatacttccaatctccccagcattctgtcgcccacaggaacacgacaa
ccatttccagaccctccttcggcccagtactcgctcgtcgaccaccaatcaccagtcaac
gcgccgccacctctaatcgcctcctcggtcgtcctcaagcccatcacccgaacgttacca
ccccctcaccagtgcccgtctcaacaactacctccccagcggttgacccttcaacccggg
atcgatcatacagccatggcgacaggcctcaaccctgaggggtccgagcccgcctcacag
caaactcgtaagaggagacgcggagagaccaactgggccgagttctaccaaaatggcttg
cctaaggaagtcatcgtgattgacgacactcccgagcccgagggtacggccaccaggagc
gtagcctctcaaacactgtccaatgcccacatcgtcaccaacccgtcagctccaactcag
ccaacagctaagaggcgcaggccgaatggccactacgaccctgtccaccacgacaactat
gttcctgcccagaaccaaacacagcggtcgctgccgtctgcttcccattccctcaactca
cccgcgtctactagcaacagcgcaaactcggcccagcacaccacgacggcgacttcgctc
ggctccctctcgtcgcatagttacaacgatgactacgcccaaccaggcacaaagcggagg
aaactcacccgacaacaggccaatgaggccaagcgtcgagaaaccgctcatgccgatacc
tttgcggtgtataaaccacctccttatcctcctaagaaggctggcgaggtacatgtcaag
gtcattcaggacacttcgccgaatcaaaacgccagagttgatgatgatgatggtcacatg
attgtgattcccggaaatgatcttacggagagatacgagatacttaaattgcttggccaa
ggcacttttggtaaagtcgtgcaggccaaagacaagaagcgcaacaagcttgtcgcgatc
aagatcattcggtctgtgcagaagtacagggacgccagtaaaatagaacttcgtgtactg
gcaactttgaaggcgaacgacgaggagaataggaaccgttgcatccatctccgggattgc
ttcgatttccgtggccacatctgcatcgtcatggatttgcttgggcagagcgtgtttgac
ttcctgaaggacaacaatttcgtgccctttcccaacagtcagatcctggcctttgctcgt
cagttgttcactagcgtggctttcttgcacgacctcaacctgattcataccgacctcaaa
cccgagaacatcttgctctgcaatcaagagtatcagacgtttacatactcccgcaccatt
ccgtcatcttccacgctcaccaatcgcagagccgtgcatagaaaggttcttctagacaca
gagatcaggctcatcgattttgggtccgccacctttcaagatgaatatcattcatctgtc
gtaagcacgcgacattatcgtgcgcccgaaatcatacttggactggggtggtcctttccc
tgcgacatctggagcattggctgcatcctggtcgagttttacacaggtgacgctttgttc
cagacgcacgataacctggagcatctcgcaatgatggaggctgtagtcaaccataaaatt
gacccttcgcttgtccaacaagtcaacaggatgaccaggaatggtggaaacccggccgcg
aagtttttcaagcgctcgaaactggactaccctgctcccgataccacccgtgcatccaag
agattcgtaaagggcatgaaacctctcgatgagattatccctgctagaaatagtcgcttt
cttgctctgttcctggatcttctaaagaagatctttatgtatgatcccaataagcgtatc
accgccaggcaagcccttgagcacgaatggttcagagagcacctcccgccagacgacggt
accgaagccacccgaatcaggctcgaaaaggaagcagaaagacaacgccgggaggtggaa
gcgcgaagaactatgctaccggccatgcacgcagcatga

DBGET integrated database retrieval system