KEGG   Neurospora crassa: NCU00230Help
Entry
NCU00230          CDS       T01034                                 

Definition
similar to protein kinase Lkh1
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
ncr  Neurospora crassa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 552 aa AA seqDB search
MSTPITATATLPRAYSDRYHSQFAYQHHHQPYPVQANASSFYSQNTSNLPSILSPTGTRQ
PFPDPPSAQYSLVDHQSPVNAPPPLIASSVVLKPITRTLPPPHQCPSQQLPPQRLTLQPG
IDHTAMATGLNPEGSEPASQQTRKRRRGETNWAEFYQNGLPKEVIVIDDTPEPEGTATRS
VASQTLSNAHIVTNPSAPTQPTAKRRRPNGHYDPVHHDNYVPAQNQTQRSLPSASHSLNS
PASTSNSANSAQHTTTATSLGSLSSHSYNDDYAQPGTKRRKLTRQQANEAKRRETAHADT
FAVYKPPPYPPKKAGEVHVKVIQDTSPNQNARVDDDDGHMIVIPGNDLTERYEILKLLGQ
GTFGKVVQAKDKKRNKLVAIKIIRSVQKYRDASKIELRVLATLKANDEENRNRCIHLRDC
FDFRGHICIVMDLLGQSVFDFLKDNNFVPFPNSQILAFARQLFTSVAFLHDLNLIHTDLK
PENILLCNQEYQTFTYSRTIPSSSTLTNRRAVHRKVLLDTEIRLIDFGSATFQDEYHSSV
DDQEWWKPGREK
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcccataaccgccacagcaacgctgcctcgcgcctattcggaccggtaccat
tcgcagtttgcataccagcatcatcatcagccttatcccgtccaggccaacgcctcctcg
ttttattcccagaatacttccaatctccccagcattctgtcgcccacaggaacacgacaa
ccatttccagaccctccttcggcccagtactcgctcgtcgaccaccaatcaccagtcaac
gcgccgccacctctaatcgcctcctcggtcgtcctcaagcccatcacccgaacgttacca
ccccctcaccagtgcccgtctcaacaactacctccccagcggttgacccttcaacccggg
atcgatcatacagccatggcgacaggcctcaaccctgaggggtccgagcccgcctcacag
caaactcgtaagaggagacgcggagagaccaactgggccgagttctaccaaaatggcttg
cctaaggaagtcatcgtgattgacgacactcccgagcccgagggtacggccaccaggagc
gtagcctctcaaacactgtccaatgcccacatcgtcaccaacccgtcagctccaactcag
ccaacagctaagaggcgcaggccgaatggccactacgaccctgtccaccacgacaactat
gttcctgcccagaaccaaacacagcggtcgctgccgtctgcttcccattccctcaactca
cccgcgtctactagcaacagcgcaaactcggcccagcacaccacgacggcgacttcgctc
ggctccctctcgtcgcatagttacaacgatgactacgcccaaccaggcacaaagcggagg
aaactcacccgacaacaggccaatgaggccaagcgtcgagaaaccgctcatgccgatacc
tttgcggtgtataaaccacctccttatcctcctaagaaggctggcgaggtacatgtcaag
gtcattcaggacacttcgccgaatcaaaacgccagagttgatgatgatgatggtcacatg
attgtgattcccggaaatgatcttacggagagatacgagatacttaaattgcttggccaa
ggcacttttggtaaagtcgtgcaggccaaagacaagaagcgcaacaagcttgtcgcgatc
aagatcattcggtctgtgcagaagtacagggacgccagtaaaatagaacttcgtgtactg
gcaactttgaaggcgaacgacgaggagaataggaaccgttgcatccatctccgggattgc
ttcgatttccgtggccacatctgcatcgtcatggatttgcttgggcagagcgtgtttgac
ttcctgaaggacaacaatttcgtgccctttcccaacagtcagatcctggcctttgctcgt
cagttgttcactagcgtggctttcttgcacgacctcaacctgattcataccgacctcaaa
cccgagaacatcttgctctgcaatcaagagtatcagacgtttacatactcccgcaccatt
ccgtcatcttccacgctcaccaatcgcagagccgtgcatagaaaggttcttctagacaca
gagatcaggctcatcgattttgggtccgccacctttcaagatgaatatcattcatctgtc
gatgaccaggaatggtggaaacccggccgcgaaaaatag

DBGET integrated database retrieval system