KEGG   Neurospora crassa: NCU00273Help
Entry
NCU00273          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ncr  Neurospora crassa
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NCU00273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 1730 aa AA seqDB search
MAELRKFESLYALHTELQAVSQQRYEELQTVEQLLEQHADSFSKFLDKPPRNPTSRTALQ
SGRIKVQDEEYSVTQSFINDALKLADELDLDEVEAARVLLDADAEGDQASFDRPLWVCGL
LRFQNERSYLLDCMRLCIQIANDEDIDPSVQEGFGQVVDERIFGIPAQGSKPQAGAQKFV
PKCVAGLQAIRSTLQSIGEKVAAQNVLFQPNVSKRMDQQEPSEIMRLKLIEQHETLSLIL
CAAVEKKQAESKDFKEFIQLLRKVDKYDHLLVHLIPVLGAYIATFGSNVGGGDVEPARQL
NEFICGRTAEDVWAIPSLGAAVRAWWIAEYSGWYHDDYAGYEARGINLDKEDEERTKQFM
DALKDGAFDYLLAVAADCHAHNQDWQDPTRWGMRQWLQRKTTPLASEALPFAPHFHSCLM
THLEVLIDAAISNIPDVLRKLRTEEDEQRQLSQTHEQDLDLERFLMIIAYAYDGRPDAAM
TFWEDTESNLAGFLNWASRRASTPLVSAFCEMLQALAANEECATAAHNFLLDETTHSGGK
LKRSASLTWNQIFKELKFFMEKLQTKPLPAPSQLVRHHAKPSSDQAETEPESAMMLECYL
RLIAKLGYESPVARNLLLLDTSVELPETLIRLASAQIPGRLRACVFNAFRALMHRKTHQE
SEIMWDFIDLWLVGGWGPKADTQRTVAMLQPSPQAVMEAILDDISDGFEQPVAFIQLLIS
LIQPSIDDGELCDKLPFKETLGTSNRLSGVDVYVDYVFGLVLTKKAMDITDPMQLRILQL
SCLEFALASLASFNEDLIVLGNESNVNVDVAVSTSSLEAYVRLHPFARVMEWLFNEKVVN
ILVDIINRDTDVLGQSSHDSPVVLGVLRAVQVMIKVLELQDTYLDLVRPLIKKQSGQRSR
SVASGAYSAFEDGIMNHLSLVEDLGRFTNLGNPDLTWASLKLLEKISTSPEIISAWEPDG
RHAHRNKAIVQLERGGAGVSIAASLANTIAQTLDPVLEAESPDYQTKVFILDFLYKCLKA
NPDKPTIAHLLLGFRCEINGLAIEPNGAFDIQRSLFHSLLNAFIGLSVYQEELELRATNF
LFHTLLQEPQVQPHLRWDGVEAASPEFLVTDASHSYIEFLATRAMAFEYIAKELCSVSQK
RIPTVKRQIFDALLNGQIRADDEEPINIANIFDFFDFLNVDFVDIPAPEFDIYRDIDLTP
CIEEDAMTGSQFNVHKVHELALLKRAERLNRDNPEKKDSQALITQDELAAWDREQSLLLE
YVIYRNRQKQFSAHRLKVLRAWTNILLVMFEANDFKGTPKIAFLLQALQAILPSLEAFST
LSPAEAFELARVAKVLLFKLDLSDNTDGATDKDIGNLISDKLFQLFQVCLTSIASWVGSA
DLRALYYSICYRYLTSVVDKTTDHTGTTTSNALATARSRAIRAIQAYGDRLLNVICDDAY
GSDSTCQTAAMILLGALVHLDHTTTASGLQHTNDLDGSFVVTTLNRLNFIGVLVDSLKTI
LKDWSAVTTSPTSSVEQQQQQQPPSSQQLTLATQSPATDSQYILSKLSLLLALCRSKLGS
KFVLQSNLFRALEVSGAFSTDPELFVRQQQQNSSTGSTTYVRALERHYTLLVYLARIVSA
AVMAGKKRGSHNALQGRKFLQGARGLVVQVLKMSVGIGGAGSGNLGVSMRAVNGSAYSGA
DRDSQAQLELEERVDELAEAFMLLINATGFLEFEEEQTAAEKPKGDLLFH
NT seq 5193 nt NT seq  +upstreamnt  +downstreamnt
atggccgaactacgtaaattcgaatctctctacgccctccacaccgagctccaggctgtc
agccagcagcgctatgaagaactccagaccgtcgagcagctgctcgagcagcacgcggat
tccttcagcaagttcctagacaagccaccccggaaccccaccagcaggacggccctacag
agtggcaggatcaaggttcaggacgaggaatattccgtcacccagagcttcatcaacgac
gcccttaagcttgccgatgagctcgatctcgacgaagtcgaggctgcccgtgtccttctc
gatgccgatgccgagggcgaccaggccagtttcgaccgtcccttgtgggtgtgcggcctc
ctccgcttccaaaacgagcggagttacctgctcgactgtatgcgcctttgcatccagata
gcaaacgacgaggacatcgacccctcggtgcaggaaggctttggccaggttgtcgacgag
aggatctttggcattcccgcccagggtagcaagccccaggccggcgcccagaaattcgtg
cccaaatgtgtggccggactccaagccatcaggtcgactctgcaaagtatcggggagaag
gtggcagctcaaaatgtcctgtttcagcccaacgtctccaagcggatggaccagcaagaa
ccgtctgagatcatgcgcctcaagctaatagagcaacacgaaaccctgtccctcatactg
tgtgccgcagtcgagaagaagcaagccgagtccaaggatttcaaggagttcatccagctc
ctgaggaaagtagataaatacgatcaccttttagtgcatctcatcccggtacttggtgcc
tatatcgcaacctttggttccaatgtgggtggtggagacgttgagccggcacgacaactg
aacgagtttatctgtggaaggacagccgaggatgtctgggcgataccgagtctcggcgct
gcggtgcgcgcatggtggatcgccgagtatagcggctggtatcacgatgattacgccggc
tacgaagcgcggggcatcaacctggacaaggaggacgaggagaggacaaaacaattcatg
gatgccctgaaggacggcgccttcgactatcttctcgccgttgccgccgactgccatgcg
cataatcaggactggcaggaccctacacgctggggaatgcgtcaatggttgcagcgcaag
actacgcctctggcatctgaagctctgcccttcgcgcctcatttccactcctgtctaatg
acacacctcgaggtactcatcgatgctgccatctccaatatcccagacgttttgcgtaag
ttgaggacggaggaggacgagcagcgccagttgagccaaacacacgagcaggaccttgat
ctggaacgcttcctcatgatcattgcctacgcctacgatggccgaccggacgcagccatg
actttctgggaagataccgaaagcaacctcgccggcttcttgaattgggcgtccaggaga
gcttccacccctctggtcagcgccttctgcgagatgctgcaagctcttgctgctaatgaa
gaatgcgcgacagccgcccacaacttcttgctcgacgaaaccactcactcggggggcaag
ttgaaacgctcagcctccttgacttggaaccaaatcttcaaggaactcaagttcttcatg
gagaaactccaaaccaagccacttcccgccccgtctcagcttgtccgtcaccatgcaaag
cccagcagcgatcaggccgaaactgaacctgaatccgccatgatgctggagtgctacctg
cgcctcattgccaaactcggctatgaaagcccagtcgccagaaatcttctacttctcgac
acaagcgtggagctacccgaaactctgatcaggcttgctagtgcccagatacccggccgt
ctccgggcttgtgttttcaatgccttccgcgccctaatgcatcgcaagacccatcaggag
tcggaaatcatgtgggactttatcgacctttggctagtaggaggttggggtcccaaggcg
gacacacaacgaaccgtggcaatgttacagcccagtcctcaggcggtgatggaggctatc
ttggacgacatcagtgatggatttgagcagcccgttgcctttatccagttacttatttcg
ctcatccagccctcgattgatgatggagagctttgcgacaaactgcctttcaaggaaacg
ctgggcaccagtaaccgactgtctggcgttgatgtctatgttgactatgtctttggtctc
gtgttgaccaagaaggctatggatatcaccgatcctatgcagctgaggatccttcagctc
agctgcctggagtttgcgcttgcttctctggcatcgttcaacgaagacctcattgtcttg
ggtaacgagagcaacgtcaatgttgatgttgccgtgtctacgtcaagcctagaagcctat
gtgcgcctgcacccatttgcccgggttatggagtggttgttcaatgaaaaggttgtgaac
attcttgtcgacatcatcaacagggatacggatgtgcttggacagtcgtcccacgattcc
cccgttgttttgggtgttctgcgagccgtccaggtcatgatcaaggtccttgagctacaa
gacacttatctcgatctcgtccgcccccttatcaagaagcagtctggacagcgaagccgc
tctgtcgcgagtggggcttattctgctttcgaagatggcattatgaaccacctgtctctc
gtggaggatctcggccggttcaccaaccttggaaaccccgacctcacctgggcttccctt
aagctcttggagaagatttcgacatcccccgagatcatctcggcctgggaacccgatggt
cgtcatgcgcatcgcaacaaggccattgtccagctcgagaggggtggggcaggtgtgtcg
attgccgcgtctttggccaacaccatcgcccagacgctcgatcctgttctggaggccgaa
tcgccggattaccaaaccaaggtgttcatcctcgatttcctatacaaatgtctcaaagcc
aacccggacaaacccaccatcgctcatctactccttggcttccgctgcgagatcaacggg
cttgccattgaacccaatggtgcctttgatattcagcgatcactcttccatagcctgttg
aacgcgttcattggcttgtcagtataccaagaggagttggagttgcgagctactaacttc
ctcttccacaccctgctccaagagccacaagtccaaccacacctcaggtgggacggcgta
gaagcggcttctcccgagttcctggtcacggacgcatcgcattcttatatcgagttcctt
gcgacgcgtgccatggcctttgaatacattgccaaggagctttgcagtgtgtcccaaaag
cggatacccaccgtcaagcgccaaatatttgatgccctgctgaatggacagatccgggcc
gacgacgaggagcccatcaacattgctaatatctttgactttttcgacttcctcaacgtc
gactttgtggacattcccgccccggaattcgatatttacagggacatcgacctcactcca
tgcatcgaggaggacgcaatgaccgggtcccaatttaacgttcacaaagtccacgagttg
gccttgctcaagcgcgctgagaggctcaaccgggacaacccggaaaagaaggatagccag
gccctaatcacacaagatgagctggcagcctgggaccgtgagcagagtctcttgctcgaa
tatgtcatctaccggaaccgccagaagcagttcagcgcccaccgccttaaggtactccgg
gcgtggaccaacatcctgctggtcatgttcgaggccaatgacttcaagggcacgcccaag
atcgccttcctcctgcaagcgctgcaggccattttgcccagcctggaggccttcagcaca
ctcagccccgccgaggcttttgagcttgctcgcgttgccaaggtgctactcttcaagctc
gacctctcggacaataccgatggcgccaccgacaaggacattggcaacctcatcagtgac
aagctctttcagcttttccaagtctgcctcacctccatcgccagctgggtcggcagtgcc
gatttgcgcgctctttactactccatctgctaccggtacctcacgtcggtagtcgacaag
accaccgaccacaccggcaccaccaccagcaacgccctggccacggcccgctcccgcgcc
atcagggccatccaagcctatggcgaccgtctccttaacgtcatctgcgatgacgcctac
ggctccgactcgacgtgccaaaccgcggccatgatccttttgggagccctcgtccatctc
gatcacaccacgacggcttccggtctccagcacaccaacgatctagacggctcctttgta
gttaccaccctgaaccgtctcaactttatcggcgttctcgtcgattctctcaagaccatt
ttaaaggattggtctgctgtcaccacttcccccacttcctccgtcgaacagcaacagcaa
caacagccaccatcatcccaacaactcacactcgccactcaatcacccgccacagacagc
caatatatcctttccaaactctctctcctccttgccctctgtcgctccaagctcggctcc
aaattcgttctccagtcgaacctcttccgcgccctagaagtgtcgggtgctttctccacc
gacccagaacttttcgttcgtcagcaacaacaaaattcctcgacaggctcgacgacctat
gtccgcgctttggaaaggcactatacgctcctcgtgtatctagccagaatcgtctcagcg
gcggtcatggccggcaagaagcgcgggagtcataatgcgctgcagggacgcaagttcttg
caaggggctagggggttagtggttcaggtgttgaagatgagtgtggggattggtggtgct
gggtcggggaaccttggcgtctcgatgagggcggtgaatggaagtgcgtacagtggtgcg
gatagggatagccaggcacagttggagttggaagaacgcgtggatgagctggcggaggcg
tttatgcttttgattaacgctaccgggtttttggagttcgaggaagagcaaacggctgct
gagaagccgaagggtgatctgctctttcactag

  All links  
No link information was found.   
DBGET integrated database retrieval system