KEGG   Neurospora crassa: NCU00273Help
Entry
NCU00273          CDS       T01034                                 

Definition
(RefSeq) hypothetical protein
  KO
K14310  
nuclear pore complex protein Nup205
Organism
ncr  Neurospora crassa
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NCU00273
Messenger RNA biogenesis [BR:ncr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     NCU00273
Chromosome [BR:ncr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    NCU00273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Linkage Group III; III
AA seq 1762 aa AA seqDB search
MAELRKFESLYALHTELQAVSQQRYEELQTVEQLLEQHADSFSKFLDKPPRNPTSRTALQ
SGRIKVQDEEYSVTQSFINDALKLADELDLDEVEAARVLLDADAEGDQASFDRPLWVCGL
LRFQNERSYLLDCMRLCIQIANDEDIDPSVQEGFGQVVDERIFGIPAQGSKPQAGAQKFV
PKCVAGLQAIRSTLQSIGEKVAAQNVLFQPNVSKRMDQQEPSEIMRLKLIEQHETLSLIL
CAAVEKKQAESKDFKEFIQLLRKVDKYDHLLVHLIPVLGAYIATFGSNVGGGDVEPARQL
NEFICGRTAEDVWAIPSLGAAVRAWWIAEYSGWYHDDYAGYEARGINLDKEDEERTKQFM
DALKDGAFDYLLAVAADCHAHNQDWQDPTRWGMRQWLQRKTTPLASEALPFAPHFHSCLM
THLEVLIDAAISNIPDVLRKLRTEEDEQRQLSQTHEQDLDLERFLMIIAYAYDGRPDAAM
TFWEDTESNLAGFLNWASRRASTPLVSAFCEMLQALAANEECATAAHNFLLDETTHSGGK
LKRSASLTWNQIFKELKFFMEKLQTKPLPAPSQLVRHHAKPSSDQAETEPESAMMLECYL
RLIAKLGYESPVARNLLLLDTSVELPETLIRLASAQIPGRLRACVFNAFRALMHRKTHQE
SEIMWDFIDLWLVGGWGPKADTQRTVAMLQPSPQAVMEAILDDISDGFEQPVAFIQLLIS
LIQPSIDDGELCDKLPFKETLGTSNRLSGVDVYVDYVFGLVLTKKAMDITDPMQLRILQL
SCLEFALASLASFNEDLIVLGNESNVNVDVAVSTSSLEAYVRLHPFARVMEWLFNEKVVN
ILVDIINRDTDVLGQSSHDSPVVLGVLRAVQVMIKVLELQDTYLDLVRPLIKKQSGQRSR
SVASGAYSAFEDGIMNHLSLVEDLGRFTNLGNPDLTWASLKLLEKISTSPEIISAWEPDG
RHAHRNKAIVQLERGGAGVSIAASLANTIAQTLDPVLEAESPDYQTKVFILDFLYKCLKA
NPDKPTIAHLLLGFRCEINGLAIEPNGAFDIQRSLFHSLLNAFIGLSVYQEELGMRGYLI
TLKRNILRIFQILWSSPLSSQLVMEELRATNFLFHTLLQEPQVQPHLRWDGVEAASPEFL
VTDASHSYIEFLATRAMAFEYIAKELCSVSQKRIPTVKRQIFDALLNGQIRADDEEPINI
ANIFDFFDFLNVDFVDIPAPEFDIYRDIDLTPCIEEDAMTGSQFNVHKVHELALLKRAER
LNRDNPEKKDSQALITQDELAAWDREQSLLLEYVIYRNRQKQFSAHRLKVLRAWTNILLV
MFEANDFKGTPKIAFLLQALQAILPSLEAFSTLSPAEAFELARVAKVLLFKLDLSDNTDG
ATDKDIGNLISDKLFQLFQVCLTSIASWVGSADLRALYYSICYRYLTSVVDKTTDHTGTT
TSNALATARSRAIRAIQAYGDRLLNVICDDAYGSDSTCQTAAMILLGALVHLDHTTTASG
LQHTNDLDGSFVVTTLNRLNFIGVLVDSLKTILKDWSAVTTSPTSSVEQQQQQQPPSSQQ
LTLATQSPATDSQYILSKLSLLLALCRSKLGSKFVLQSNLFRALEVSGAFSTDPELFVRQ
QQQNSSTGSTTYVRALERHYTLLVYLARIVSAAVMAGKKRGSHNALQGRKFLQGARGLVV
QVLKMSVGIGGAGSGNLGVSMRAVNGSAYSGADRDSQAQLELEERVDELAEAFMLLINAT
GFLEFEEEQTAAEKPKGDLLFH
NT seq 5289 nt NT seq  +upstreamnt  +downstreamnt
atggccgaactacgtaaattcgaatctctctacgccctccacaccgagctccaggctgtc
agccagcagcgctatgaagaactccagaccgtcgagcagctgctcgagcagcacgcggat
tccttcagcaagttcctagacaagccaccccggaaccccaccagcaggacggccctacag
agtggcaggatcaaggttcaggacgaggaatattccgtcacccagagcttcatcaacgac
gcccttaagcttgccgatgagctcgatctcgacgaagtcgaggctgcccgtgtccttctc
gatgccgatgccgagggcgaccaggccagtttcgaccgtcccttgtgggtgtgcggcctc
ctccgcttccaaaacgagcggagttacctgctcgactgtatgcgcctttgcatccagata
gcaaacgacgaggacatcgacccctcggtgcaggaaggctttggccaggttgtcgacgag
aggatctttggcattcccgcccagggtagcaagccccaggccggcgcccagaaattcgtg
cccaaatgtgtggccggactccaagccatcaggtcgactctgcaaagtatcggggagaag
gtggcagctcaaaatgtcctgtttcagcccaacgtctccaagcggatggaccagcaagaa
ccgtctgagatcatgcgcctcaagctaatagagcaacacgaaaccctgtccctcatactg
tgtgccgcagtcgagaagaagcaagccgagtccaaggatttcaaggagttcatccagctc
ctgaggaaagtagataaatacgatcaccttttagtgcatctcatcccggtacttggtgcc
tatatcgcaacctttggttccaatgtgggtggtggagacgttgagccggcacgacaactg
aacgagtttatctgtggaaggacagccgaggatgtctgggcgataccgagtctcggcgct
gcggtgcgcgcatggtggatcgccgagtatagcggctggtatcacgatgattacgccggc
tacgaagcgcggggcatcaacctggacaaggaggacgaggagaggacaaaacaattcatg
gatgccctgaaggacggcgccttcgactatcttctcgccgttgccgccgactgccatgcg
cataatcaggactggcaggaccctacacgctggggaatgcgtcaatggttgcagcgcaag
actacgcctctggcatctgaagctctgcccttcgcgcctcatttccactcctgtctaatg
acacacctcgaggtactcatcgatgctgccatctccaatatcccagacgttttgcgtaag
ttgaggacggaggaggacgagcagcgccagttgagccaaacacacgagcaggaccttgat
ctggaacgcttcctcatgatcattgcctacgcctacgatggccgaccggacgcagccatg
actttctgggaagataccgaaagcaacctcgccggcttcttgaattgggcgtccaggaga
gcttccacccctctggtcagcgccttctgcgagatgctgcaagctcttgctgctaatgaa
gaatgcgcgacagccgcccacaacttcttgctcgacgaaaccactcactcggggggcaag
ttgaaacgctcagcctccttgacttggaaccaaatcttcaaggaactcaagttcttcatg
gagaaactccaaaccaagccacttcccgccccgtctcagcttgtccgtcaccatgcaaag
cccagcagcgatcaggccgaaactgaacctgaatccgccatgatgctggagtgctacctg
cgcctcattgccaaactcggctatgaaagcccagtcgccagaaatcttctacttctcgac
acaagcgtggagctacccgaaactctgatcaggcttgctagtgcccagatacccggccgt
ctccgggcttgtgttttcaatgccttccgcgccctaatgcatcgcaagacccatcaggag
tcggaaatcatgtgggactttatcgacctttggctagtaggaggttggggtcccaaggcg
gacacacaacgaaccgtggcaatgttacagcccagtcctcaggcggtgatggaggctatc
ttggacgacatcagtgatggatttgagcagcccgttgcctttatccagttacttatttcg
ctcatccagccctcgattgatgatggagagctttgcgacaaactgcctttcaaggaaacg
ctgggcaccagtaaccgactgtctggcgttgatgtctatgttgactatgtctttggtctc
gtgttgaccaagaaggctatggatatcaccgatcctatgcagctgaggatccttcagctc
agctgcctggagtttgcgcttgcttctctggcatcgttcaacgaagacctcattgtcttg
ggtaacgagagcaacgtcaatgttgatgttgccgtgtctacgtcaagcctagaagcctat
gtgcgcctgcacccatttgcccgggttatggagtggttgttcaatgaaaaggttgtgaac
attcttgtcgacatcatcaacagggatacggatgtgcttggacagtcgtcccacgattcc
cccgttgttttgggtgttctgcgagccgtccaggtcatgatcaaggtccttgagctacaa
gacacttatctcgatctcgtccgcccccttatcaagaagcagtctggacagcgaagccgc
tctgtcgcgagtggggcttattctgctttcgaagatggcattatgaaccacctgtctctc
gtggaggatctcggccggttcaccaaccttggaaaccccgacctcacctgggcttccctt
aagctcttggagaagatttcgacatcccccgagatcatctcggcctgggaacccgatggt
cgtcatgcgcatcgcaacaaggccattgtccagctcgagaggggtggggcaggtgtgtcg
attgccgcgtctttggccaacaccatcgcccagacgctcgatcctgttctggaggccgaa
tcgccggattaccaaaccaaggtgttcatcctcgatttcctatacaaatgtctcaaagcc
aacccggacaaacccaccatcgctcatctactccttggcttccgctgcgagatcaacggg
cttgccattgaacccaatggtgcctttgatattcagcgatcactcttccatagcctgttg
aacgcgttcattggcttgtcagtataccaagaggagttgggtatgcgaggctacctaata
actctcaagcggaatattttgcgcatcttccagatcctttggagctcacccctttcttca
cagttggtcatggaagagttgcgagctactaacttcctcttccacaccctgctccaagag
ccacaagtccaaccacacctcaggtgggacggcgtagaagcggcttctcccgagttcctg
gtcacggacgcatcgcattcttatatcgagttccttgcgacgcgtgccatggcctttgaa
tacattgccaaggagctttgcagtgtgtcccaaaagcggatacccaccgtcaagcgccaa
atatttgatgccctgctgaatggacagatccgggccgacgacgaggagcccatcaacatt
gctaatatctttgactttttcgacttcctcaacgtcgactttgtggacattcccgccccg
gaattcgatatttacagggacatcgacctcactccatgcatcgaggaggacgcaatgacc
gggtcccaatttaacgttcacaaagtccacgagttggccttgctcaagcgcgctgagagg
ctcaaccgggacaacccggaaaagaaggatagccaggccctaatcacacaagatgagctg
gcagcctgggaccgtgagcagagtctcttgctcgaatatgtcatctaccggaaccgccag
aagcagttcagcgcccaccgccttaaggtactccgggcgtggaccaacatcctgctggtc
atgttcgaggccaatgacttcaagggcacgcccaagatcgccttcctcctgcaagcgctg
caggccattttgcccagcctggaggccttcagcacactcagccccgccgaggcttttgag
cttgctcgcgttgccaaggtgctactcttcaagctcgacctctcggacaataccgatggc
gccaccgacaaggacattggcaacctcatcagtgacaagctctttcagcttttccaagtc
tgcctcacctccatcgccagctgggtcggcagtgccgatttgcgcgctctttactactcc
atctgctaccggtacctcacgtcggtagtcgacaagaccaccgaccacaccggcaccacc
accagcaacgccctggccacggcccgctcccgcgccatcagggccatccaagcctatggc
gaccgtctccttaacgtcatctgcgatgacgcctacggctccgactcgacgtgccaaacc
gcggccatgatccttttgggagccctcgtccatctcgatcacaccacgacggcttccggt
ctccagcacaccaacgatctagacggctcctttgtagttaccaccctgaaccgtctcaac
tttatcggcgttctcgtcgattctctcaagaccattttaaaggattggtctgctgtcacc
acttcccccacttcctccgtcgaacagcaacagcaacaacagccaccatcatcccaacaa
ctcacactcgccactcaatcacccgccacagacagccaatatatcctttccaaactctct
ctcctccttgccctctgtcgctccaagctcggctccaaattcgttctccagtcgaacctc
ttccgcgccctagaagtgtcgggtgctttctccaccgacccagaacttttcgttcgtcag
caacaacaaaattcctcgacaggctcgacgacctatgtccgcgctttggaaaggcactat
acgctcctcgtgtatctagccagaatcgtctcagcggcggtcatggccggcaagaagcgc
gggagtcataatgcgctgcagggacgcaagttcttgcaaggggctagggggttagtggtt
caggtgttgaagatgagtgtggggattggtggtgctgggtcggggaaccttggcgtctcg
atgagggcggtgaatggaagtgcgtacagtggtgcggatagggatagccaggcacagttg
gagttggaagaacgcgtggatgagctggcggaggcgtttatgcttttgattaacgctacc
gggtttttggagttcgaggaagagcaaacggctgctgagaagccgaagggtgatctgctc
tttcactag

DBGET integrated database retrieval system