KEGG   Neurospora crassa: NCU00387Help
Entry
NCU00387          CDS       T01034                                 

Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase
  KO
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     NCU00387
    1.3.1.94  polyprenol reductase
     NCU00387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Linkage Group III; III
AA seq 368 aa AA seqDB search
MEDLWKPLLDNTTLAALLQRLNDITPSQWCQAYYLFAAGAVVAVAAMPNEVSRRLVDYGA
RKVQSVKVSRSGSRSSEGKEENDTGRGTGSEAEVKAKANRVERGGDKNWLLSLTDTLTSY
GQVPHSWFITFYVASMACSLLWFWQFAVDGRVLRVVTCSQASPTAKGGDERGGVSASSVT
LGQVGLAWTMMFLQGSRRLYEDSLVHGKSKSTMWIVHWVLGLSYYLFTSVAVWVEGSGAI
LEYQSTGAIDYTMPSFKSLVGTFMFLYASVNQYRCHRHLAGLKKYSLPDLGLFRYLICPH
YFCECLVYLSLAIVAAPQGELLNKTLLCALVFVVVNLGVTAAGTRKWYAEKFGSKAVETK
WDMIPFIL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggaagacctgtggaagccattactcgacaacactacactagcagcgcttctacagagg
ctgaacgatatcaccccctcacaatggtgccaagcctactacctctttgccgcgggcgcg
gtggtggccgtagcagccatgcccaatgaagtgagcaggaggctggttgattatggggcg
aggaaagttcagtccgtaaaggtgtctcggtctgggtctagatcttctgaggggaaagag
gagaacgacaccggcaggggcacgggaagtgaagccgaagtcaaagccaaagccaaccgt
gtggagcgtggcggcgacaagaactggttgctctccttaaccgacaccctcacctcctac
ggccaagttccgcactcctggttcatcacgttttacgtggcatctatggcatgctcgctg
ttatggttttggcagtttgctgttgatgggagggtgttgagggtggttacttgcagtcaa
gcctcgcctacggcgaaggggggagatgaaagaggaggagtgtcggcgtcttcagttact
ctcggtcaagtcggcctggcctggacgatgatgttcctccagggaagcagacggctgtat
gaagactcgttggtgcacggaaagtccaaatctaccatgtggatcgtgcattgggttttg
gggctcagttattatctgtttaccagcgtggctgtttgggttgagggatctggggccata
ctggagtaccaatccacaggagcaatcgattataccatgccatctttcaagtcgttggtt
ggaaccttcatgttcctctacgcttcagtcaaccagtacagatgtcacaggcacctcgcc
gggttgaagaagtactcccttcctgatctgggcctgttccgctacctgatctgtcctcac
tacttctgcgaatgtctggtctacctttcactcgcgatcgttgccgctccccagggagag
ctgcttaacaagacgctcttgtgcgctttggtgtttgtcgtggtcaacctcggggtgacg
gcagcgggtacgcggaagtggtacgccgagaagtttgggagcaaggcggtagaaacaaaa
tgggacatgatacccttcattttgtga

DBGET integrated database retrieval system