KEGG   Neurospora crassa: NCU00480Help
Entry
NCU00480          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NCU00480
Peptidases [BR:ncr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NCU00480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 1754 aa AA seqDB search
MCLTALLRYTGSGGDPEIPSRLRLFYRCFTVRAEQGRDATAILESARCTTANLSRTPLPS
VNATTRFPQTQLYCLALLLSFVSQQLTFTTSSSKKRRVTRQSTREQGQEGSTDAALDVVL
ATEQEAEFDPAYPFDHHQSTSTSASASNTPAYSRGDSLPPSGIPPHLQSQFSTLSGSATD
YVSADSAASSPCAASADLSVDNDRDSGQLFDSSSTLQAASCGTLRSQSPFINTPHRALMG
GASEQTHRSGSPLKRRASSMDPEFENADSREDVEMLTVPDTQPQDQQPGQDVEEPQPVEA
DAVGGTKVPIADMELPLKTEIPPIEQQIKTIETLLKAFNDRGAKEGDVAYLVSRQWLNKA
QAFGANGKPTSKEPSDETIGPIDNSDIIQAIFTDSAGQQCVKLKPGVGPESAELFPKDAW
DLVLSWYGLASGQAPIVRIAHNTALDAASEPNVQFEFHPPVFTVHRLWSAASPLPIEQEI
KLKKPPPPVIVQSASASFHQFLKQIKKLTGVPMDRKVRVWQRLQTIPATEEASKPSGMET
PPDSPGRSSSIPNFLPRAPGSWPEMLVDVETFSQLERGVERDHLAAEDTTTNPNYNGRKS
LSLVGLTVDQTLIIDEQVDRDDYVSTFFTKMTNGNKTVGNGIVAQARGTVSGRNSPAPPS
VLNRGRVQPRSGRTPGCVGLQNLGNTCYMNSALQCLRSVEELTKYFLTHEAKKEINPDNP
LSHNGDVAMAYMRLLDEIYKNPAPNSVAPRHFKGIVGRYAPAFSGYGQQDSQEFLGFLLD
GLQEDLNRIKKKPYIEKPDSTDDMIGNPAAIKEMAEKVWDITKKRDDSIIADLFTGLYKS
TLHCPVCDKISITFDPFNNLTLPLPMSNVWSRTVKYYPLNEPPVEIVVEVDKTSAFKAIK
EFISTRVGVPPERLVGGEEFKGKFFKQYDDMMAINEEIQPGDVAVIHEVEAPPTNVNAKK
AKKQVYRSLLDDAEEEPAQPTSNPLAERLLVPVLHRTMDPNGAGVRYHRKVEDIPPPHYI
VLTPQEACDENIIRRKILQKVATLSTWSEFTADEEASEATDPEMVNGASDIDSADSKVVA
KSVEGEEDIVDVTMGNTGSAKPTASPAPQTLPALLKRFKSQQPKWLDPSVFLNPALQNLF
AMSYFRELHGGVPTGWQSVNDTSKHERLSSRAPKTDSSDVEMRSPNALDGSDDSGSEEAS
SEQVDSVTRMADESSEGSDAPKGSDRFIASPPRGANAVPRGKNKKMKAGRTYGKKAKKRF
EKEQLRKRAAAAQQPIEVPEQDYRVDSEEGPLVRLGEGIVVDWYEDAFDTVFSPANRTYN
KIETLNDPSLGAKKRQRELRKKHGISLDDCLAEFEKEEILSEQDTWYCPRCKEHRRASKK
FDLWKTPDILVVHLKRFSSVGWRRDKLDVLVDFPIEGLDLTERVIDKEDGKQEIYDLIAV
DDHWGGLGGGHYTAFAKNFVDDQWYEFNDSSVSKVTDTSKVVSPAAYLLFYRRRSDKPLG
GPKCEEVAQRYSLDDDEEMLDSGEGQRLGHGSSLRGSPSASNGAGQTLLRGEVGSVSGRG
PSGDSELPSYQETNGTITGPEVRKSIEFEDEGIDLPNYEAAGNMSGVASALPTTWSFDNI
PKTGSEASGLDDEIASDVAQGDNSGDDASVFAGINEYGSAVDFIGPAAQDDDYSAFTDNV
PPPPSVQDQDTMDQIAQMTWEHKEQVHEVFVNGGADIDDDKVAEIHVDDHEQQGQSPAVR
EPPKETEGGDKSSD
NT seq 5265 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcttacggcgctacttaggtacacaggttcgggaggcgacccagagatcccatcg
cggttgaggttgttttacaggtgttttacggtcagggcagaacagggccgtgacgcgacc
gcgatcctagagtccgcccgatgcaccacggctaacctatcacggacgccactacccagc
gtcaacgcaacgactcgctttccccagacccagctctattgtctggctttgctcctgtcg
tttgtcagtcagcagctcaccttcaccacgtcttcctcaaagaaacggagggttacccgc
cagtcgacaagggagcagggacaggaagggtctaccgacgctgccctagacgtggtgctc
gctaccgaacaagaagcagagttcgacccggcctacccttttgaccaccatcagtcgact
tccacatcggcctctgcctccaacactccagcatacagccgcggcgactccttaccacca
tcaggcatacccccgcaccttcagagtcagtttagcacactgtctggctcggcgaccgac
tacgtctctgccgattccgccgccagttcaccctgcgctgcctcggccgatctctccgtt
gacaacgaccgtgattccggacagctcttcgactcgagctcgactttgcaggctgccagt
tgcgggaccttgagaagtcagtctcccttcatcaatacgccccaccgtgcgctcatgggt
ggcgcttcagagcagacacatcgatctggttctcccctgaaacgaagagcatccagtatg
gatccagagtttgagaacgcggactcgcgggaggacgtggaaatgctcacggttcctgat
acccagccgcaagaccaacagcctgggcaagatgtggaagagcctcagcccgtggaagca
gacgccgtcggaggtaccaaggtgcccattgctgatatggaactgcccttgaagacagaa
atcccaccgatcgagcaacagatcaagacgatcgaaacactcctcaaggccttcaatgat
aggggcgcaaaagaaggagatgtggcatacttagtatcacggcagtggctgaacaaggcc
caggcgttcggtgctaatgggaagcctacaagcaaggagccttcagacgagactattggg
ccaattgataactcggatatcattcaagctatcttcaccgactccgccggccagcagtgc
gtgaagctaaagccgggcgtgggaccagagtctgctgagctgtttcccaaggacgcatgg
gacctggtgctgtcatggtatggtctggcgtctggacaggcccctattgtgcggatagcg
cacaataccgcccttgatgctgccagcgagcccaacgttcagtttgagttccaccccccc
gtttttaccgttcacaggctatggtcggcagcgagtcctctgcctatcgaacaggagatt
aagctgaagaagccgccaccgcccgtcattgtccaaagcgcatctgcctcatttcaccaa
tttcttaagcaaatcaagaagctgactggtgttcctatggatcgtaaagtccgggtctgg
cagcggttgcaaacaattcctgccacagaggaggcctcgaagccctctggtatggagacc
cctccagattccccagggcgttcctctagcatacccaacttcctacctagggcccctggc
tcctggccggaaatgctcgtggatgttgaaactttcagccaactagagcgtggtgtggag
cgcgatcacctcgcagcagaggataccacaaccaatcccaactacaacgggaggaagagt
ctgtcattggttggccttactgtggaccaaaccttgatcatcgacgaacaggttgaccga
gatgattacgtctctacattcttcactaaaatgaccaatggcaacaagaccgtcggcaac
ggcattgtcgctcaggcccgtggtactgtcagcggacgtaacagcccggctcccccgagt
gtcctcaataggggccgggtgcaacccagatccggtcgtacgccagggtgcgttggcttg
cagaacctgggcaatacatgctacatgaattcggctctgcaatgtctacggagcgttgaa
gagttgaccaagtatttcctcactcacgaggccaagaaagagatcaaccctgacaatccg
ctttcccataacggagacgttgctatggcatacatgcggctgttggatgaaatatacaag
aatcctgcgcccaactcggtcgcgccccgtcacttcaaaggcatcgtgggccgatatgcc
cccgccttctctggctatgggcagcaggactcccaagaattcttgggtttcttgctcgat
ggcctacaagaggacctgaaccgcatcaagaagaagccgtacattgagaagccagactct
acagatgacatgatcggtaaccctgctgctatcaaagaaatggccgagaaggtttgggat
atcacaaagaagcgtgacgactcgatcattgccgacctgtttaccggattatacaagtca
acccttcattgccctgtgtgcgacaagatcagcatcacattcgatcccttcaacaacctc
actttgcccttgccaatgagcaacgtctggtcccggactgtcaagtattatcccttaaac
gaacccccagtggaaatcgttgtagaggtcgataagacgagcgctttcaaggccataaag
gagttcatttcgacgagagtcggtgtccccccggagcgtcttgttggaggtgaagagttc
aagggtaaattcttcaagcagtacgacgacatgatggcgatcaacgaagagattcagccg
ggtgacgttgcagtgatacatgaagtggaagcgccgcctaccaatgtcaacgcaaagaag
gccaagaagcaggtatacaggtcgctgctggacgatgccgaggaagagcccgctcaaccc
acgtcgaatcccctggcggaacgtctccttgttccagttctgcatcgtactatggaccct
aatggggccggtgtcagatatcataggaaagtagaggacatcccaccgccacattacatt
gtgttgacgcctcaggaggcttgtgatgagaatatcatccgcagaaaaatcctgcaaaag
gtggccaccttgtctacgtggtcggaattcactgccgacgaagaggcatcagaagctacg
gatcccgagatggtcaatggcgcatcggatattgactctgcagactctaaggtagttgcc
aagtccgtcgagggcgaggaagatattgtcgacgtgacgatgggcaacactggttctgcc
aaaccaacagcgtcgccagctcctcaaactcttccggcgctcctcaagcgtttcaagtcg
cagcagcctaagtggttagacccttcagtttttctgaatccagccctgcagaacctcttt
gcgatgtcttactttagggagttgcatggcggtgttcctacagggtggcaaagcgtcaac
gacaccagcaaacacgaaagactgagctcgagggcccctaagacggattcgtcggatgtg
gagatgcggagcccgaatgcattggatggctcggatgacagcggtagcgaagaagcttct
tcggaacaggtagattccgtgacacggatggccgatgagtcgagcgagggctcggatgcc
ccgaaaggaagtgatcgattcatcgctagtcctcctaggggagcaaatgccgttccacga
ggcaaaaacaagaagatgaaagctggccgcacttatggcaagaaggctaagaagcgtttt
gagaaagaacagctgagaaaacgggctgcggccgcccagcaacccatcgaggtccctgag
caagattaccgtgtcgactccgaggaagggccccttgtgcgtcttggcgaaggcatcgtt
gtggactggtacgaggacgcttttgatactgtcttctcccctgcgaacaggacctacaac
aagattgagactctaaatgacccgtcgttgggtgccaagaagaggcaacgggagctgcgt
aagaagcacggtatcagtctagatgattgtttggccgagttcgagaaggaagaaatcttg
tccgagcaagatacatggtattgtccccgttgcaaggagcaccgtcgcgcaagcaagaaa
ttcgacctttggaagacgccagatattctagtcgtccatctgaaacgctttagctccgtt
ggctggcgtcgggataagctggatgtccttgtcgacttccccatcgagggcctcgacctc
accgagcgggtcattgacaaggaagacggtaaacaggagatctatgacctgattgctgtg
gatgaccattggggcggcttgggcggtggccattacactgcctttgccaagaattttgtt
gatgatcagtggtatgagttcaatgattcatccgtttcgaaggtgaccgatacctccaag
gttgtctcacccgctgcctacttgctgttctaccgtcgccgctcagacaaacctctaggc
gggcccaaatgcgaggaagtcgcccagcgctattcccttgacgacgatgaggaaatgctg
gactcgggggaaggccagcgtctcggtcatggctcctcccttcgtgggtcgccgagcgct
tcgaacggagcaggtcaaactctcctgcgaggagaagttggttcggttagtggccgcggt
ccaagtggcgactccgaactgccctcctatcaggaaaccaatggcacgattactggtcct
gaggtgcggaagagcatcgagtttgaggacgagggcattgatctacccaactacgaagcc
gcgggcaacatgtccggcgtggcctctgctctccccacaacctggagctttgacaacatt
cccaagaccggctccgaagcgagtggcttggacgacgagattgcgagtgatgtggcacaa
ggcgacaactccggggacgatgcctcggtctttgccggtatcaatgaatatggctccgct
gtagatttcatcggacctgctgcacaggacgacgattactcggcattcactgacaatgtc
ccgccgccgccgtcagtgcaggatcaggacaccatggaccaaatcgcgcagatgacatgg
gaacacaaggagcaagttcatgaggtgttcgtcaatggcggcgctgacattgacgacgat
aaggttgcggagattcacgtcgacgatcacgagcagcaaggacaatcaccagcagttcgg
gaaccgccaaaggagacggaaggaggcgataagtcgtcagactag

DBGET integrated database retrieval system