KEGG   Neurospora crassa: NCU00587Help
Entry
NCU00587          CDS       T01034                                 

Definition
similar to MAP kinase kinase Pbs2
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ncr  Neurospora crassa
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NCU00587
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     NCU00587
Protein kinases [BR:ncr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   NCU00587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
I
AA seq 637 aa AA seqDB search
MSDHDPDHGPASPNEYDDESNPASPGSVDESSEASTPMDPPSSGSDAMPGFTPEGDLPRR
VPSLRTISDPQHTNSMSPSSSVPGTLNAARRPAASAANLPTDLMAKARALHQQRMGMAPR
PSMSPQNSGLGMGPMGSGMGGMGSMGGMGHSMNLNMNHGGPAPGGLPGGLRLPPGIARPP
PQGFPKSAPAIAGLGAKKAPSLSERRAMKLGGLPGGPGSPVTATPKLSDMGAEDAKAPAI
NGEGRGSKLSDFKNYIDAEKGWITFADAATITRTGVNFANGQTFRISLDEVEVMDELGKG
NYGTVYKVRHSKVMAMKEIRLELDESKFSTILKELVILHECASPYIIDFYGAFYQEGAVY
MCIEYMDGGSIDKLYAGGIPENVLRKITYATIMGLKCLKEDHNIIHRDVKPTNILVNTNG
QVKICDFGVSGNLVASIAKTNIGCQSYMAPERISGGGMSAAGGAAAGTYSVQSDIWSLGL
TIIECAMGRYPYPPEVSSTIFSQLSAIVEGDPPGLPSEGYSGTAQDFVKSCLNKIPAKRH
TYPMLLMHPWIKSLGRPETITEEVEAEEKAADDQLADATGSLDINSNGPINDQGDREVAE
WVTNVLDRKLKGLLSDKAEKPALHAAPLDQVSPGIAA
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccacgatcccgatcacggcccagctagcccaaatgaatatgacgatgagagc
aacccggcttcgccaggctcagtcgacgagtcgtctgaggcaagcacgcccatggacccg
ccaagctcaggttcagatgcgatgcctggtttcacaccagaaggcgacctgcctcgcaga
gtgccatcattacggaccatctccgacccgcaacacacgaattcaatgagccctagttcg
agtgttcctgggacattgaatgccgcacgaagacctgcggcatccgcagcaaatcttcca
acggacctcatggcaaaggcacgagctctgcatcaacagcggatgggcatggctccccga
cccagcatgtcgccgcagaacagtggactgggtatgggccctatgggatcgggcatgggc
gggatgggaagtatggggggcatgggacacagcatgaatttgaacatgaatcacggcggt
ccggcacccggcggcctgcccggcggccttcggttacctccaggtatagcacgaccaccg
ccccaaggcttccccaaatccgcacctgccatagccggtctgggagctaaaaaggccccc
agtctgagcgaacgacgagcgatgaagctcggagggctaccaggagggcctgggtcgccg
gtgactgccacgccgaaactgtcagacatgggcgccgaagacgccaaagcgccagccatt
aatggagaagggcgcggatccaagctgagcgatttcaagaactatatcgacgcagaaaag
gggtggataactttcgcagacgcagcaaccatcacacggacaggcgtcaacttcgccaac
ggacagaccttcagaatctcgctagacgaggtcgaagtgatggacgagctaggcaagggc
aactatggtaccgtctacaaagttcgacatagcaaggtcatggcgatgaaagagatcaga
ctcgagctggatgaatccaagttttccactattctcaaggaactcgtaattctccacgag
tgcgcttcgccctacatcattgatttctacggcgccttttaccaagaaggcgcggtatat
atgtgcatcgagtacatggatggcggcagtatagacaagctatatgccggaggtatcccc
gaaaatgtcttgcgcaagattacatatgcaacgatcatgggcctcaagtgtctaaaagaa
gatcacaacatcatccatcgcgatgtcaagcccaccaatattctggtcaacacgaatgga
caagtcaagatctgcgattttggcgtttcgggaaatctcgttgccagtatagcaaagacc
aacattggctgccagagttacatggcaccagaacgcatcagcggtggtggcatgtcagct
gcgggcggcgcggctgccgggacctacagcgtacaaagcgatatttggagtttgggtctc
accattatcgagtgtgccatgggtcgatacccatacccgcctgaggtttctagcacaatc
ttcagtcaactcagtgccatcgttgagggcgaccctcccggcctcccaagtgagggctac
tccggcacagcacaggactttgtcaagtcctgtctcaacaagatccctgccaagcgccac
acctacccgatgttgctgatgcacccatggatcaagtccctcggcaggcccgagactatc
acggaagaagtggaagccgaagagaaggccgcggacgaccagctcgccgacgccaccggc
tcgctcgacatcaacagtaacggaccgatcaacgaccagggcgatcgtgaggtcgctgag
tgggtcaccaacgttctggaccgcaagctcaagggcttgctcagtgataaggccgagaag
cccgctctgcacgctgcaccgctggatcaagtgagcccgggcattgccgcttag

DBGET integrated database retrieval system