KEGG   Neurospora crassa: NCU00621Help
Entry
NCU00621          CDS       T01034                                 

Definition
(RefSeq) TORC1 growth control complex subunit Kog1
  KO
K07204  
regulatory associated protein of mTOR
Organism
ncr  Neurospora crassa
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
I
AA seq 1473 aa AA seqDB search
MTAVSLHASHPGSAEFGQRQPSAPTPTSGRYARPGFPSSTATSPSRHTMNNPARQSSVTM
SQVHPQRPEDGNQRVATNGTSHPAAHNQLPLRSNIQRRMSDSSPAPLFRRPSSAPDDNNQ
TSPGTTLHGGQSDDDDHMPVARPAKAPLTRSKSEYGLRLERESPIEQVDEEYHDWGARHG
FEDHYQSEEVISQLANSWYMYFTDKRHETTGKPKTPAFEIQDWRMRDRLKTVSAAIAVCL
NIGVEPPDQLRTTPGARLEAWQDPTVPPVSKALENIGKALQSQYETLAIRTRYKQYLDPS
IEETKRFSVSLRRSAKDERVLFHYNGHGVPKPTASGEIWVFNKNYTQYIPVSLYDLQQWL
QAPTIYVWDCSEAGNILTNYHRFVEKHEQEEEEAAQRDPNHEKINFRPYIHLAACNVKEN
LPTNPDLPADLFTCCLTTPIEMALWFFCLQNPLKTKISPERAKKLPGRLQERRTPLGELN
WIFTAITDTIAWTTLPRHLFRKFFRQDLMVAALFRNFLLAQRIMPVYNCHPQSYPELPDT
RQHPLWESWDLAVDLALAQLPALERKESEGIEYEYINSSFFAEQLTAFEIYLTRGDALSQ
KPPDQLPVVLQVLLSQQHRVRALVLLARFLDLGPWAVQLALSIGIFPYVLKLLQSAAQDL
KPVMVFIWTRVLAVDISCQQDLIKDSGYNYFAAIMKPQDTLSMVSVGFLDEHKAMCAFIL
AMLCKDYKPGQLVCNSTDIMTYCLYHIARPEGPLLKQWSCLCISQLWKDLPEGKWRGIRE
NATSKLSHLSRDPNPEVRAAMAHAMTTFLGIPDLTDEVARIEESVAWTMLELATDGSPIV
RKELLVFFSHFVLRYESKFLVAAFEQLSEEKDYLASPPPEDGQDHRMGLHYTRRENRERD
GSIKPSAFGVAHDSIFAACWKHINILSVDPHPETQRDATIIVDYVHNALLQSPLTTQTQN
LMDEILRRSRKVSRGDMSQRSAAAGTHAAVAQPLPSPGLLKRTASYLFGPLMGTLDPSST
SIPPLSPGLQRSGSRSSRKGPGLDSAPPEQNDQATSPANYHVANEPSCAGYKERSMKDLP
SLPLVSTFLDWSIEYFREPQMKASEAEEPGSHEYNERLWRRSRNEAVLRETQPQKTHART
HKWNDQIGVINNGSQPAKLSFHQFENYVAVADDGNTVNVWDWKQGTRKSRFSNGNPEGSK
ISDMKFINEDDQALLMTGSSDGVIRVYRNYDSNENIELASAWRALTHMVPSNVNSGMVFD
WQQVKGQVLVAGDERVIRIWNAGHEMCTHEIPARSGSCVTSLTSDQMTGNIFVAGFGDGA
IRVFDTRMKPQESMVRKWKDEKRQWVRSVHMQRGGQRELLSASRNGKIRLWDIRMDQPLK
SFQTTKDVLRTASTHEHLPVFAVGTSAHLVKVFDFDGHELTRIEPYSSFLQGHKGTPISA
TAFHPHRMVLGCAARGDYHVNLFACGNEKVGPF
NT seq 4422 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgtttctcttcacgcctcccaccccggctccgcagaatttggccagagacag
ccctctgctcccactcccacctctggccgttacgcgaggcccggctttccgtcatcaact
gctacatcaccatcccgccacacaatgaacaacccagctcgtcaaagttcagtcacaatg
tcacaagtccatcctcagaggccagaagacggcaaccagcgcgtcgcgacaaacgggacc
tctcatcctgctgcccataaccagctgccacttcgatccaacatacagagacgcatgtcc
gattcctcaccagcgcccttgtttcgacgcccctccagcgcccccgacgacaataaccaa
acatctcctggaaccacgttgcatggcgggcaatctgatgacgacgaccatatgcctgtc
gcccggccggccaaggcgccattaacgcggtctaagagcgaatacggactgcggttggag
agggaaagccccatcgaacaagttgacgaagagtaccatgattggggtgccaggcatggg
ttcgaggaccattatcagtctgaagaagtcatttctcagcttgcaaatagctggtacatg
tactttaccgataagcgacatgagacaacagggaagccaaagacacccgctttcgagatc
caagactggcgtatgcgcgatcgcctaaaaacagtttctgctgcgatagcagtatgcttg
aacataggagtggaaccgccagatcaacttcgcaccaccccgggtgcccggcttgaagct
tggcaagatccgacggtgcctcctgtttccaaggcactggagaatattgggaaagctttg
caatctcaatatgagacccttgctattcggacgcgctacaagcagtatttagacccgtcc
atcgaagaaaccaagcggttcagtgtctccctccgaagaagtgccaaggacgagcgtgtg
ctcttccattacaatgggcatggagtgcccaagccaacagcctcgggagagatctgggtt
ttcaacaagaactacacgcagtatatccccgtctctctctacgaccttcagcaatggttg
caggcgcccacgatatatgtgtgggattgctccgaggctggcaatatcctcaccaattac
caccgttttgttgagaagcacgagcaagaagaagaggaggcggcacaacgggacccaaac
cacgaaaagattaacttccgtccctacatccatctggcagcctgcaacgtcaaggagaat
ctgccaaccaaccccgacctgcctgctgatctcttcacttgctgcttgactacccctata
gagatggcactctggttcttctgtctgcaaaatccgctaaaaaccaaaatatctcctgag
cgagccaagaagctgccagggcggcttcaggagcgccggacgcctctcggagagctcaac
tggattttcactgccatcacagataccattgcatggaccacgctaccacgccatctcttc
cgcaaattttttaggcaagatttgatggttgccgctcttttccgaaactttctcctcgca
cagcgtatcatgcctgtgtacaactgccatccccagtcgtatccagagttgccagataca
cgtcagcatcccctttgggagagctgggacttggccgtcgatctggctcttgcccagttg
ccggccctcgagagaaaggagagtgaagggatagagtatgagtacatcaactcgtcattc
ttcgcggagcagctcacagcattcgagatctacttgactcgaggggatgctttgtcccag
aagccacctgaccagcttccagtggttctgcaagtgttgctaagtcagcagcatcgagta
cgagctctggtcctactagcaaggttcttggaccttggcccttgggcagtacaactggcg
ctcagcattggcatcttcccgtacgtcttgaagctcctccagtcggcggcacaagaccta
aagccagtcatggtgttcatctggactcgcgttcttgcggtcgatatctcatgccagcaa
gacctcatcaaagatagcgggtacaattacttcgcggccataatgaagccgcaagatacc
ctctccatggttagcgtcgggttcttggatgagcacaaggcgatgtgtgctttcatcttg
gctatgctgtgcaaagactataaacctggacagcttgtgtgtaactcaactgacattatg
acctattgcctgtaccatattgcacgcccagaaggccccctcctgaagcaatggtcatgc
ctctgcatcagccagctctggaaggaccttcctgaaggtaaatggaggggcattcgggag
aacgccacttcgaaactctcccaccttagtagggaccccaaccctgaagtacgggcagct
atggcgcatgctatgaccacgttcctaggaatcccggatctcacggacgaagttgcgagg
atcgaggaaagcgttgcctggaccatgcttgaactggctacagacggcagcccgattgtc
cgaaaagagcttctagtcttcttctctcatttcgttctgcgttatgagagcaagttcctg
gttgccgccttcgagcaactatccgaggagaaggattatcttgcttcgcctccgccagag
gatggccaagatcacagaatggggttacactatactcgccgagaaaaccgggagagagat
ggcagtatcaaaccatcagcatttggtgtagcgcatgattcgatcttcgctgcctgctgg
aaacacatcaacatcttgagcgtggatccacatcccgaaacccaaagagatgccaccatc
atcgtggattatgttcacaatgcacttcttcaatcaccacttacaacgcaaacgcaaaat
ctcatggacgagatcctccggcgctctagaaaagtgtcgaggggtgatatgagccagaga
agcgccgctgccggcactcacgctgcagtcgcacagccattgccttcgccaggccttctc
aagaggactgcaagttacctgtttggccccctcatggggaccctggacccttcttcaacc
tcgattccgccactgtcccctgggctacaaagaagtggatctcgaagcagccgaaaaggt
ccgggcctggattctgcgccacctgagcagaatgatcaggctacttcgccagcaaactac
cacgttgccaacgaaccgtcatgtgctggttataaagagcgcagcatgaaagacctgcct
agcctaccattggtaagcacgttcttggactggtccatagagtatttccgcgagccgcag
atgaaagcatcggaggccgaagagcccggcagccacgagtacaacgaacgcctctggcgc
cgttcacgcaacgaggccgttttgagagagactcagccccagaagacgcatgcgcgaacc
cacaagtggaatgaccaaatcggcgtcattaacaatggttcacaaccggcgaaactcagc
tttcatcagtttgagaattacgtggccgtcgcagatgacgggaatacagtgaacgtgtgg
gattggaaacagggtacccggaagagtcgtttctccaacggcaacccagaaggctccaag
atctcagacatgaagttcatcaacgaagacgatcaagcgctgttgatgacggggtcatca
gacggtgtaatccgcgtttaccggaattacgacagcaatgagaacatcgagctggcatca
gcttggcgcgctctgacgcacatggttccgtccaacgtcaactcgggcatggtgttcgac
tggcaacaggtcaagggtcaggtgctcgtggccggggatgagagggtcattcgcatctgg
aatgccggtcatgaaatgtgtacccatgaaattccagcacgatccggctcctgcgttact
tcgctcacgtcagatcagatgacaggcaacatctttgtcgccggatttggcgacggggct
atcagagtcttcgatactcgcatgaagccgcaggaaagcatggttcggaaatggaaggac
gagaagaggcagtgggtacgatcggtgcacatgcaacgcggtggacagagagaactgttg
tcggccagccgcaacggcaagatccggttgtgggatattcgtatggaccagccgctcaaa
tcgttccagaccaccaaggacgtactcaggacggcaagcacccatgaacacttgcctgtc
tttgctgttggaacttcggcgcatctcgtcaaggtctttgactttgatggccatgagctg
acccggatcgagccctactccagctttctccagggccacaagggcacgcctatttctgct
actgcattccatcctcatcggatggttttgggttgcgctgctcgcggggactatcacgtc
aacctgtttgcttgtgggaacgagaaggttggccccttctag

DBGET integrated database retrieval system