KEGG   Neurospora crassa: NCU00621Help
Entry
NCU00621          CDS       T01034                                 

Definition
similar to meiotic regulator-interacting protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ncr  Neurospora crassa
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 1414 aa AA seqDB search
MSQVHPQRPEDGNQRVATNGTSHPAAHNQLPLRSNIQRRMSDSSPAPLFRRPSSAPDDNN
QTSPGTTLHGGQSDDDDHMPVARPAKAPLTRSKSEYGLRLERESPIEQVDEEYHDWGARH
GFEDHYQSEEVISQLANSWYMYFTDKRHETTGKPKTPAFEIQDWRMRDRLKTVSAAIAVC
LNIGVEPPDQLRTTPGARLEAWQDPTVPPVSKALENIGKALQSQYETLAIRTRYKQYLDP
SIEETKRFSVSLRRSAKDERVLFHYNGHGVPKPTASGEIWVFNKNYTQYIPVSLYDLQQW
LQAPTIYVWDCSEAGNILTNYHRFVEKHEQEEEEAAQRDPNHEKINFRPYIHLAACNVKE
NLPTNPDLPADLFTCCLTTPIEMALWFFCLQNPLKTKISPERAKKLPGRLQERRTPLGEL
NWIFTAITDTIAWTTLPRHLFRKFFRQDLMVAALFRNFLLAQRIMPVYNCHPQSYPELPD
TRQHPLWESWDLAVDLALAQLPALERKESEGIEYEYINSSFFAEQLTAFEIYLTRGDALS
QKPPDQLPVVLQVLLSQQHRVRALVLLARFLDLGPWAVQLALSIGIFPYVLKLLQSAAQD
LKPVMVFIWTRVLAVDISCQQDLIKDSGYNYFAAIMKPQDTLSMVSVGFLDEHKAMCAFI
LAMLCKDYKPGQLVCNSTDIMTYCLYHIARPEGPLLKQWSCLCISQLWKDLPEGKWRGIR
ENATSKLSHLSRDPNPEVRAAMAHAMTTFLGIPDLTDEVARIEESVAWTMLELATDGSPI
VRKELLVFFSHFVLRYESKFLVAAFEQLSEEKDYLASPPPEDGQDHRMGLHYTRRENRER
DGSIKPSAFGVAHDSIFAACWKHINILSVDPHPETQRDATIIVDYVHNALLQSPLTTQTQ
NLMDEILRRSRKVSRGDMSQRSAAAGTHAAVAQPLPSPGLLKRTASYLFGPLMGTLDPSS
TSIPPLSPGLQRSGSRSSRKGPGLDSAPPEQNDQATSPANYHVANEPSCAGYKERSMKDL
PSLPLVSTFLDWSIEYFREPQMKASEAEEPGSHEYNERLWRRSRNEAVLRETQPQKTHAR
THKWNDQIGVINNGSQPAKLSFHQFENYVAVADDGNTVNVWDWKQGTRKSRFSNGNPEGS
KISDMKFINEDDQALLMTGSSDGVIRVYRNYDSNENIELASAWRALTHMVPSNVNSGMVF
DWQQVKGQVLVAGDERVIRIWNAGHEMCTHEIPARSGSCVTSLTSDQMTGNIFVAGFGDG
AIRVFDTRMKPQESMVRKWKDEKRQWVRSVHMQRGGQRELLSASRNGKIRLWDIRMDQPL
KSFQTTKDVLRTASTHEHLPVFAVGTSAHLVKVFDFDGHELTRIEPYSSFLQGHKGTPIS
ATAFHPHRMVLGCAARGDYHVNLFACGNEKVGPF
NT seq 4245 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagtccatcctcagaggccagaagacggcaaccagcgcgtcgcgacaaacggg
acctctcatcctgctgcccataaccagctgccacttcgatccaacatacagagacgcatg
tccgattcctcaccagcgcccttgtttcgacgcccctccagcgcccccgacgacaataac
caaacatctcctggaaccacgttgcatggcgggcaatctgatgacgacgaccatatgcct
gtcgcccggccggccaaggcgccattaacgcggtctaagagcgaatacggactgcggttg
gagagggaaagccccatcgaacaagttgacgaagagtaccatgattggggtgccaggcat
gggttcgaggaccattatcagtctgaagaagtcatttctcagcttgcaaatagctggtac
atgtactttaccgataagcgacatgagacaacagggaagccaaagacacccgctttcgag
atccaagactggcgtatgcgcgatcgcctaaaaacagtttctgctgcgatagcagtatgc
ttgaacataggagtggaaccgccagatcaacttcgcaccaccccgggtgcccggcttgaa
gcttggcaagatccgacggtgcctcctgtttccaaggcactggagaatattgggaaagct
ttgcaatctcaatatgagacccttgctattcggacgcgctacaagcagtatttagacccg
tccatcgaagaaaccaagcggttcagtgtctccctccgaagaagtgccaaggacgagcgt
gtgctcttccattacaatgggcatggagtgcccaagccaacagcctcgggagagatctgg
gttttcaacaagaactacacgcagtatatccccgtctctctctacgaccttcagcaatgg
ttgcaggcgcccacgatatatgtgtgggattgctccgaggctggcaatatcctcaccaat
taccaccgttttgttgagaagcacgagcaagaagaagaggaggcggcacaacgggaccca
aaccacgaaaagattaacttccgtccctacatccatctggcagcctgcaacgtcaaggag
aatctgccaaccaaccccgacctgcctgctgatctcttcacttgctgcttgactacccct
atagagatggcactctggttcttctgtctgcaaaatccgctaaaaaccaaaatatctcct
gagcgagccaagaagctgccagggcggcttcaggagcgccggacgcctctcggagagctc
aactggattttcactgccatcacagataccattgcatggaccacgctaccacgccatctc
ttccgcaaattttttaggcaagatttgatggttgccgctcttttccgaaactttctcctc
gcacagcgtatcatgcctgtgtacaactgccatccccagtcgtatccagagttgccagat
acacgtcagcatcccctttgggagagctgggacttggccgtcgatctggctcttgcccag
ttgccggccctcgagagaaaggagagtgaagggatagagtatgagtacatcaactcgtca
ttcttcgcggagcagctcacagcattcgagatctacttgactcgaggggatgctttgtcc
cagaagccacctgaccagcttccagtggttctgcaagtgttgctaagtcagcagcatcga
gtacgagctctggtcctactagcaaggttcttggaccttggcccttgggcagtacaactg
gcgctcagcattggcatcttcccgtacgtcttgaagctcctccagtcggcggcacaagac
ctaaagccagtcatggtgttcatctggactcgcgttcttgcggtcgatatctcatgccag
caagacctcatcaaagatagcgggtacaattacttcgcggccataatgaagccgcaagat
accctctccatggttagcgtcgggttcttggatgagcacaaggcgatgtgtgctttcatc
ttggctatgctgtgcaaagactataaacctggacagcttgtgtgtaactcaactgacatt
atgacctattgcctgtaccatattgcacgcccagaaggccccctcctgaagcaatggtca
tgcctctgcatcagccagctctggaaggaccttcctgaaggtaaatggaggggcattcgg
gagaacgccacttcgaaactctcccaccttagtagggaccccaaccctgaagtacgggca
gctatggcgcatgctatgaccacgttcctaggaatcccggatctcacggacgaagttgcg
aggatcgaggaaagcgttgcctggaccatgcttgaactggctacagacggcagcccgatt
gtccgaaaagagcttctagtcttcttctctcatttcgttctgcgttatgagagcaagttc
ctggttgccgccttcgagcaactatccgaggagaaggattatcttgcttcgcctccgcca
gaggatggccaagatcacagaatggggttacactatactcgccgagaaaaccgggagaga
gatggcagtatcaaaccatcagcatttggtgtagcgcatgattcgatcttcgctgcctgc
tggaaacacatcaacatcttgagcgtggatccacatcccgaaacccaaagagatgccacc
atcatcgtggattatgttcacaatgcacttcttcaatcaccacttacaacgcaaacgcaa
aatctcatggacgagatcctccggcgctctagaaaagtgtcgaggggtgatatgagccag
agaagcgccgctgccggcactcacgctgcagtcgcacagccattgccttcgccaggcctt
ctcaagaggactgcaagttacctgtttggccccctcatggggaccctggacccttcttca
acctcgattccgccactgtcccctgggctacaaagaagtggatctcgaagcagccgaaaa
ggtccgggcctggattctgcgccacctgagcagaatgatcaggctacttcgccagcaaac
taccacgttgccaacgaaccgtcatgtgctggttataaagagcgcagcatgaaagacctg
cctagcctaccattggtaagcacgttcttggactggtccatagagtatttccgcgagccg
cagatgaaagcatcggaggccgaagagcccggcagccacgagtacaacgaacgcctctgg
cgccgttcacgcaacgaggccgttttgagagagactcagccccagaagacgcatgcgcga
acccacaagtggaatgaccaaatcggcgtcattaacaatggttcacaaccggcgaaactc
agctttcatcagtttgagaattacgtggccgtcgcagatgacgggaatacagtgaacgtg
tgggattggaaacagggtacccggaagagtcgtttctccaacggcaacccagaaggctcc
aagatctcagacatgaagttcatcaacgaagacgatcaagcgctgttgatgacggggtca
tcagacggtgtaatccgcgtttaccggaattacgacagcaatgagaacatcgagctggca
tcagcttggcgcgctctgacgcacatggttccgtccaacgtcaactcgggcatggtgttc
gactggcaacaggtcaagggtcaggtgctcgtggccggggatgagagggtcattcgcatc
tggaatgccggtcatgaaatgtgtacccatgaaattccagcacgatccggctcctgcgtt
acttcgctcacgtcagatcagatgacaggcaacatctttgtcgccggatttggcgacggg
gctatcagagtcttcgatactcgcatgaagccgcaggaaagcatggttcggaaatggaag
gacgagaagaggcagtgggtacgatcggtgcacatgcaacgcggtggacagagagaactg
ttgtcggccagccgcaacggcaagatccggttgtgggatattcgtatggaccagccgctc
aaatcgttccagaccaccaaggacgtactcaggacggcaagcacccatgaacacttgcct
gtctttgctgttggaacttcggcgcatctcgtcaaggtctttgactttgatggccatgag
ctgacccggatcgagccctactccagctttctccagggccacaagggcacgcctatttct
gctactgcattccatcctcatcggatggttttgggttgcgctgctcgcggggactatcac
gtcaacctgtttgcttgtgggaacgagaaggttggccccttctag

DBGET integrated database retrieval system