KEGG   Neurospora crassa: NCU00621Help
Entry
NCU00621          CDS       T01034                                 

Definition
(RefSeq) TORC1 growth control complex subunit Kog1
  KO
K07204  
regulatory associated protein of mTOR
Organism
ncr  Neurospora crassa
Pathway
Autophagy - other
Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    NCU00621
   04136 Autophagy - other eukaryotes
    NCU00621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 1473 aa AA seqDB search
MTAVSLHASHPGSAEFGQRQPSAPTPTSGRYARPGFPSSTATSPSRHTMNNPARQSSVTM
SQVHPQRPEDGNQRVATNGTSHPAAHNQLPLRSNIQRRMSDSSPAPLFRRPSSAPDDNNQ
TSPGTTLHGGQSDDDDHMPVARPAKAPLTRSKSEYGLRLERESPIEQVDEEYHDWGARHG
FEDHYQSEEVISQLANSWYMYFTDKRHETTGKPKTPAFEIQDWRMRDRLKTVSAAIAVCL
NIGVEPPDQLRTTPGARLEAWQDPTVPPVSKALENIGKALQSQYETLAIRTRYKQYLDPS
IEETKRFSVSLRRSAKDERVLFHYNGHGVPKPTASGEIWVFNKNYTQYIPVSLYDLQQWL
QAPTIYVWDCSEAGNILTNYHRFVEKHEQEEEEAAQRDPNHEKINFRPYIHLAACNVKEN
LPTNPDLPADLFTCCLTTPIEMALWFFCLQNPLKTKISPERAKKLPGRLQERRTPLGELN
WIFTAITDTIAWTTLPRHLFRKFFRQDLMVAALFRNFLLAQRIMPVYNCHPQSYPELPDT
RQHPLWESWDLAVDLALAQLPALERKESEGIEYEYINSSFFAEQLTAFEIYLTRGDALSQ
KPPDQLPVVLQVLLSQQHRVRALVLLARFLDLGPWAVQLALSIGIFPYVLKLLQSAAQDL
KPVMVFIWTRVLAVDISCQQDLIKDSGYNYFAAIMKPQDTLSMVSVGFLDEHKAMCAFIL
AMLCKDYKPGQLVCNSTDIMTYCLYHIARPEGPLLKQWSCLCISQLWKDLPEGKWRGIRE
NATSKLSHLSRDPNPEVRAAMAHAMTTFLGIPDLTDEVARIEESVAWTMLELATDGSPIV
RKELLVFFSHFVLRYESKFLVAAFEQLSEEKDYLASPPPEDGQDHRMGLHYTRRENRERD
GSIKPSAFGVAHDSIFAACWKHINILSVDPHPETQRDATIIVDYVHNALLQSPLTTQTQN
LMDEILRRSRKVSRGDMSQRSAAAGTHAAVAQPLPSPGLLKRTASYLFGPLMGTLDPSST
SIPPLSPGLQRSGSRSSRKGPGLDSAPPEQNDQATSPANYHVANEPSCAGYKERSMKDLP
SLPLVSTFLDWSIEYFREPQMKASEAEEPGSHEYNERLWRRSRNEAVLRETQPQKTHART
HKWNDQIGVINNGSQPAKLSFHQFENYVAVADDGNTVNVWDWKQGTRKSRFSNGNPEGSK
ISDMKFINEDDQALLMTGSSDGVIRVYRNYDSNENIELASAWRALTHMVPSNVNSGMVFD
WQQVKGQVLVAGDERVIRIWNAGHEMCTHEIPARSGSCVTSLTSDQMTGNIFVAGFGDGA
IRVFDTRMKPQESMVRKWKDEKRQWVRSVHMQRGGQRELLSASRNGKIRLWDIRMDQPLK
SFQTTKDVLRTASTHEHLPVFAVGTSAHLVKVFDFDGHELTRIEPYSSFLQGHKGTPISA
TAFHPHRMVLGCAARGDYHVNLFACGNEKVGPF
NT seq 4422 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgtttctcttcacgcctcccaccccggctccgcagaatttggccagagacag
ccctctgctcccactcccacctctggccgttacgcgaggcccggctttccgtcatcaact
gctacatcaccatcccgccacacaatgaacaacccagctcgtcaaagttcagtcacaatg
tcacaagtccatcctcagaggccagaagacggcaaccagcgcgtcgcgacaaacgggacc
tctcatcctgctgcccataaccagctgccacttcgatccaacatacagagacgcatgtcc
gattcctcaccagcgcccttgtttcgacgcccctccagcgcccccgacgacaataaccaa
acatctcctggaaccacgttgcatggcgggcaatctgatgacgacgaccatatgcctgtc
gcccggccggccaaggcgccattaacgcggtctaagagcgaatacggactgcggttggag
agggaaagccccatcgaacaagttgacgaagagtaccatgattggggtgccaggcatggg
ttcgaggaccattatcagtctgaagaagtcatttctcagcttgcaaatagctggtacatg
tactttaccgataagcgacatgagacaacagggaagccaaagacacccgctttcgagatc
caagactggcgtatgcgcgatcgcctaaaaacagtttctgctgcgatagcagtatgcttg
aacataggagtggaaccgccagatcaacttcgcaccaccccgggtgcccggcttgaagct
tggcaagatccgacggtgcctcctgtttccaaggcactggagaatattgggaaagctttg
caatctcaatatgagacccttgctattcggacgcgctacaagcagtatttagacccgtcc
atcgaagaaaccaagcggttcagtgtctccctccgaagaagtgccaaggacgagcgtgtg
ctcttccattacaatgggcatggagtgcccaagccaacagcctcgggagagatctgggtt
ttcaacaagaactacacgcagtatatccccgtctctctctacgaccttcagcaatggttg
caggcgcccacgatatatgtgtgggattgctccgaggctggcaatatcctcaccaattac
caccgttttgttgagaagcacgagcaagaagaagaggaggcggcacaacgggacccaaac
cacgaaaagattaacttccgtccctacatccatctggcagcctgcaacgtcaaggagaat
ctgccaaccaaccccgacctgcctgctgatctcttcacttgctgcttgactacccctata
gagatggcactctggttcttctgtctgcaaaatccgctaaaaaccaaaatatctcctgag
cgagccaagaagctgccagggcggcttcaggagcgccggacgcctctcggagagctcaac
tggattttcactgccatcacagataccattgcatggaccacgctaccacgccatctcttc
cgcaaattttttaggcaagatttgatggttgccgctcttttccgaaactttctcctcgca
cagcgtatcatgcctgtgtacaactgccatccccagtcgtatccagagttgccagataca
cgtcagcatcccctttgggagagctgggacttggccgtcgatctggctcttgcccagttg
ccggccctcgagagaaaggagagtgaagggatagagtatgagtacatcaactcgtcattc
ttcgcggagcagctcacagcattcgagatctacttgactcgaggggatgctttgtcccag
aagccacctgaccagcttccagtggttctgcaagtgttgctaagtcagcagcatcgagta
cgagctctggtcctactagcaaggttcttggaccttggcccttgggcagtacaactggcg
ctcagcattggcatcttcccgtacgtcttgaagctcctccagtcggcggcacaagaccta
aagccagtcatggtgttcatctggactcgcgttcttgcggtcgatatctcatgccagcaa
gacctcatcaaagatagcgggtacaattacttcgcggccataatgaagccgcaagatacc
ctctccatggttagcgtcgggttcttggatgagcacaaggcgatgtgtgctttcatcttg
gctatgctgtgcaaagactataaacctggacagcttgtgtgtaactcaactgacattatg
acctattgcctgtaccatattgcacgcccagaaggccccctcctgaagcaatggtcatgc
ctctgcatcagccagctctggaaggaccttcctgaaggtaaatggaggggcattcgggag
aacgccacttcgaaactctcccaccttagtagggaccccaaccctgaagtacgggcagct
atggcgcatgctatgaccacgttcctaggaatcccggatctcacggacgaagttgcgagg
atcgaggaaagcgttgcctggaccatgcttgaactggctacagacggcagcccgattgtc
cgaaaagagcttctagtcttcttctctcatttcgttctgcgttatgagagcaagttcctg
gttgccgccttcgagcaactatccgaggagaaggattatcttgcttcgcctccgccagag
gatggccaagatcacagaatggggttacactatactcgccgagaaaaccgggagagagat
ggcagtatcaaaccatcagcatttggtgtagcgcatgattcgatcttcgctgcctgctgg
aaacacatcaacatcttgagcgtggatccacatcccgaaacccaaagagatgccaccatc
atcgtggattatgttcacaatgcacttcttcaatcaccacttacaacgcaaacgcaaaat
ctcatggacgagatcctccggcgctctagaaaagtgtcgaggggtgatatgagccagaga
agcgccgctgccggcactcacgctgcagtcgcacagccattgccttcgccaggccttctc
aagaggactgcaagttacctgtttggccccctcatggggaccctggacccttcttcaacc
tcgattccgccactgtcccctgggctacaaagaagtggatctcgaagcagccgaaaaggt
ccgggcctggattctgcgccacctgagcagaatgatcaggctacttcgccagcaaactac
cacgttgccaacgaaccgtcatgtgctggttataaagagcgcagcatgaaagacctgcct
agcctaccattggtaagcacgttcttggactggtccatagagtatttccgcgagccgcag
atgaaagcatcggaggccgaagagcccggcagccacgagtacaacgaacgcctctggcgc
cgttcacgcaacgaggccgttttgagagagactcagccccagaagacgcatgcgcgaacc
cacaagtggaatgaccaaatcggcgtcattaacaatggttcacaaccggcgaaactcagc
tttcatcagtttgagaattacgtggccgtcgcagatgacgggaatacagtgaacgtgtgg
gattggaaacagggtacccggaagagtcgtttctccaacggcaacccagaaggctccaag
atctcagacatgaagttcatcaacgaagacgatcaagcgctgttgatgacggggtcatca
gacggtgtaatccgcgtttaccggaattacgacagcaatgagaacatcgagctggcatca
gcttggcgcgctctgacgcacatggttccgtccaacgtcaactcgggcatggtgttcgac
tggcaacaggtcaagggtcaggtgctcgtggccggggatgagagggtcattcgcatctgg
aatgccggtcatgaaatgtgtacccatgaaattccagcacgatccggctcctgcgttact
tcgctcacgtcagatcagatgacaggcaacatctttgtcgccggatttggcgacggggct
atcagagtcttcgatactcgcatgaagccgcaggaaagcatggttcggaaatggaaggac
gagaagaggcagtgggtacgatcggtgcacatgcaacgcggtggacagagagaactgttg
tcggccagccgcaacggcaagatccggttgtgggatattcgtatggaccagccgctcaaa
tcgttccagaccaccaaggacgtactcaggacggcaagcacccatgaacacttgcctgtc
tttgctgttggaacttcggcgcatctcgtcaaggtctttgactttgatggccatgagctg
acccggatcgagccctactccagctttctccagggccacaagggcacgcctatttctgct
actgcattccatcctcatcggatggttttgggttgcgctgctcgcggggactatcacgtc
aacctgtttgcttgtgggaacgagaaggttggccccttctag

DBGET integrated database retrieval system