KEGG   Neurospora crassa: NCU00629Help
Entry
NCU00629          CDS       T01034                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ncr  Neurospora crassa
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ncr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ncr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ncr00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ncr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ncr00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ncr00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ncr00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 787 aa AA seqDB search
MSSAPIKMAPRKKIAIMTSGGDSPGMNAVVRSCVRMAIHMGCDAYCVYEGYEGLVRGGDF
IKQMDWFDVRGWLSEGGTLIGTARCMAFYERAGRLTAAKNMILNGIDALIICGGDGSLTG
ADRFRAEWPSLLEELVSTGELTAEQIQAYKHLNIVGIVGSIDNDLSGTDATVGCYSALAR
ICLCIDMIEATASSHSRAFVVEVMGRHCGWLALMAAVATGADFLFIPEKPREDNWREEMR
SVIQQRKTIVLIAEGALDKFGNKITPEEVRDLLADKNGLALDTRITTLGHVQRGGTAVAY
DRMLATLQGVEAVKAVLEATPETKTCFIAITENKIVRKPLMEAVLDTKQVAKAIESQDFD
GAMALRDAEFSEQYKSFMMTTAGQIDHETLLPEKERMKIGFINVGAPAGGMNAAVRAGVS
YCLSRGHEPIAIHNGFAGFARHHADSPGSVRPFDWLEVDGWASKGGSEIGTNRELPSESG
METIANLIEQYQFDALFLIGGFEAFHAVSQLRKAREQYPSLCIPMTLLPATISNNVPGTE
YSLGSDTCLNELVDYCDKIKQSASATRRRVFVIETQGGRSGYIATLAGLGVGASAVYLPE
EGLSLEMLSEDVRHLKEVFAQDKGQSRAGRLILINEKASKVYNAKLIADILRDEAHGRFE
SREGIPGHMQQGGVPSGMDRCRAVRLAIKCIQQLEKYGRNVHNRVKMDPMSASVIGIKGA
SVIFTPVQKLEEEETDWPNRRPKAAFWLSMKEIVDILGGRPRHTLPEPDLTGVKAKDVKR
GLEPVAN
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcagcacccatcaagatggcgcccagaaagaaaatcgccatcatgacctcgggc
ggcgattcccccggcatgaacgctgtggtacgctcgtgcgtccgcatggccatccacatg
ggctgcgacgcctactgcgtctacgaaggctacgagggtctggttagaggtggtgacttc
ataaagcagatggactggtttgatgtgcgcggctggctctcggaaggcggcaccttgatc
ggtaccgctcgctgcatggctttctacgagcgcgctggtcgccttactgccgccaagaac
atgattctcaacggcatcgatgccctcattatctgcggaggagacggctctcttaccggt
gccgacaggttccgtgccgagtggccttcgctgttggaagagctggtctctactggcgag
ctgacggccgagcaaattcaggcttacaagcacctcaacatcgttggtatcgtcggttct
atcgacaacgatctgtctggtacagacgccaccgttggctgctattcggctttggcaaga
atttgcttgtgtatcgatatgattgaggctaccgcctcttcccattcccgtgccttcgtc
gttgaagtcatgggcagacactgcggttggctggctttgatggcagctgttgcgacaggc
gcagatttcctctttattcccgagaaacctagggaggacaactggagagaggaaatgcgt
agcgttatccagcagcgcaagaccatcgtcctcatcgctgagggtgctctcgacaagttt
ggtaacaagatcacccccgaagaagtaagagatcttctcgccgacaagaatggcctcgcc
ctcgatacccgcatcactaccctcggccacgttcaacgcggtggtactgccgtcgcatat
gacagaatgctcgcgactcttcagggtgttgaggccgtcaaggctgtcttggaagccact
cccgagaccaagacttgcttcattgccattaccgaaaacaagattgtcaggaagcccctg
atggaggcggtactggataccaagcaagtcgccaaggcgattgaaagccaggattttgac
ggagccatggctcttcgtgatgccgagttttcggagcagtacaagtcgttcatgatgaca
actgcaggccagatcgatcacgagacattgctgcctgaaaaggagcgcatgaaaatcggc
tttatcaacgtcggtgcccccgctggaggtatgaatgccgccgtccgcgctggtgtgtcg
tactgcttgtctcgtggtcacgaacccattgcgatccacaacggctttgcaggcttcgcg
cgccatcatgccgattcgccgggctcagtgcggccctttgactggcttgaggttgatggc
tgggctagcaagggcggttccgaaatcggcaccaaccgtgagctcccgagcgagtctggc
atggagaccatcgccaacctcatcgagcagtaccagtttgacgccctgttcctcatcggt
ggcttcgaggctttccacgccgtctcgcagttgcgcaaggccagagagcagtacccctct
ctgtgcatccccatgacgctgctcccagcgaccatctccaacaacgttcccggcactgag
tactctcttggttccgatacttgccttaacgagcttgtcgactattgcgacaagatcaag
cagtccgcgtctgccactcgcagacgtgtctttgtcattgagacacagggtggccgttcg
ggttacatcgcaactctcgccggtctcggtgttggtgcctcggccgtttaccttcctgaa
gaaggtcttagcttggaaatgctcagcgaagacgtccgtcacttgaaggaggtgttcgct
caggacaagggacagagcagagccggtcgcttgatcctgatcaatgagaaggcctccaag
gtttacaatgccaagctcatcgccgacattctccgcgacgaggcccacggtcgttttgaa
agtcgtgagggtattcccggtcacatgcagcagggtggtgttccctcgggcatggaccgt
tgccgtgctgttcgtttggccatcaagtgcattcagcagcttgagaagtatggacgcaac
gtgcacaaccgcgtcaagatggatcccatgagcgctagcgtcatcggtatcaagggagcg
agtgttatctttacgccggtccagaagttggaggaggaggagaccgactggcccaacaga
cgccccaaggctgccttctggcttagtatgaaggagattgttgacatccttggaggccgt
cctcggcacaccttgcccgagcccgaccttacgggcgtcaaggccaaggacgtgaagcgt
ggactggagccggttgccaattaa

DBGET integrated database retrieval system