KEGG   Neurospora crassa: NCU00629Help
Entry
NCU00629          CDS       T01034                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ncr  Neurospora crassa
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCU00629
   01230 Biosynthesis of amino acids
    NCU00629
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCU00629
   00030 Pentose phosphate pathway
    NCU00629
   00051 Fructose and mannose metabolism
    NCU00629
   00052 Galactose metabolism
    NCU00629
  Energy metabolism
   00680 Methane metabolism
    NCU00629
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    NCU00629
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NCU00629
Protein phosphatases and associated proteins [BR:ncr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NCU00629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 787 aa AA seqDB search
MSSAPIKMAPRKKIAIMTSGGDSPGMNAVVRSCVRMAIHMGCDAYCVYEGYEGLVRGGDF
IKQMDWFDVRGWLSEGGTLIGTARCMAFYERAGRLTAAKNMILNGIDALIICGGDGSLTG
ADRFRAEWPSLLEELVSTGELTAEQIQAYKHLNIVGIVGSIDNDLSGTDATVGCYSALAR
ICLCIDMIEATASSHSRAFVVEVMGRHCGWLALMAAVATGADFLFIPEKPREDNWREEMR
SVIQQRKTIVLIAEGALDKFGNKITPEEVRDLLADKNGLALDTRITTLGHVQRGGTAVAY
DRMLATLQGVEAVKAVLEATPETKTCFIAITENKIVRKPLMEAVLDTKQVAKAIESQDFD
GAMALRDAEFSEQYKSFMMTTAGQIDHETLLPEKERMKIGFINVGAPAGGMNAAVRAGVS
YCLSRGHEPIAIHNGFAGFARHHADSPGSVRPFDWLEVDGWASKGGSEIGTNRELPSESG
METIANLIEQYQFDALFLIGGFEAFHAVSQLRKAREQYPSLCIPMTLLPATISNNVPGTE
YSLGSDTCLNELVDYCDKIKQSASATRRRVFVIETQGGRSGYIATLAGLGVGASAVYLPE
EGLSLEMLSEDVRHLKEVFAQDKGQSRAGRLILINEKASKVYNAKLIADILRDEAHGRFE
SREGIPGHMQQGGVPSGMDRCRAVRLAIKCIQQLEKYGRNVHNRVKMDPMSASVIGIKGA
SVIFTPVQKLEEEETDWPNRRPKAAFWLSMKEIVDILGGRPRHTLPEPDLTGVKAKDVKR
GLEPVAN
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcagcacccatcaagatggcgcccagaaagaaaatcgccatcatgacctcgggc
ggcgattcccccggcatgaacgctgtggtacgctcgtgcgtccgcatggccatccacatg
ggctgcgacgcctactgcgtctacgaaggctacgagggtctggttagaggtggtgacttc
ataaagcagatggactggtttgatgtgcgcggctggctctcggaaggcggcaccttgatc
ggtaccgctcgctgcatggctttctacgagcgcgctggtcgccttactgccgccaagaac
atgattctcaacggcatcgatgccctcattatctgcggaggagacggctctcttaccggt
gccgacaggttccgtgccgagtggccttcgctgttggaagagctggtctctactggcgag
ctgacggccgagcaaattcaggcttacaagcacctcaacatcgttggtatcgtcggttct
atcgacaacgatctgtctggtacagacgccaccgttggctgctattcggctttggcaaga
atttgcttgtgtatcgatatgattgaggctaccgcctcttcccattcccgtgccttcgtc
gttgaagtcatgggcagacactgcggttggctggctttgatggcagctgttgcgacaggc
gcagatttcctctttattcccgagaaacctagggaggacaactggagagaggaaatgcgt
agcgttatccagcagcgcaagaccatcgtcctcatcgctgagggtgctctcgacaagttt
ggtaacaagatcacccccgaagaagtaagagatcttctcgccgacaagaatggcctcgcc
ctcgatacccgcatcactaccctcggccacgttcaacgcggtggtactgccgtcgcatat
gacagaatgctcgcgactcttcagggtgttgaggccgtcaaggctgtcttggaagccact
cccgagaccaagacttgcttcattgccattaccgaaaacaagattgtcaggaagcccctg
atggaggcggtactggataccaagcaagtcgccaaggcgattgaaagccaggattttgac
ggagccatggctcttcgtgatgccgagttttcggagcagtacaagtcgttcatgatgaca
actgcaggccagatcgatcacgagacattgctgcctgaaaaggagcgcatgaaaatcggc
tttatcaacgtcggtgcccccgctggaggtatgaatgccgccgtccgcgctggtgtgtcg
tactgcttgtctcgtggtcacgaacccattgcgatccacaacggctttgcaggcttcgcg
cgccatcatgccgattcgccgggctcagtgcggccctttgactggcttgaggttgatggc
tgggctagcaagggcggttccgaaatcggcaccaaccgtgagctcccgagcgagtctggc
atggagaccatcgccaacctcatcgagcagtaccagtttgacgccctgttcctcatcggt
ggcttcgaggctttccacgccgtctcgcagttgcgcaaggccagagagcagtacccctct
ctgtgcatccccatgacgctgctcccagcgaccatctccaacaacgttcccggcactgag
tactctcttggttccgatacttgccttaacgagcttgtcgactattgcgacaagatcaag
cagtccgcgtctgccactcgcagacgtgtctttgtcattgagacacagggtggccgttcg
ggttacatcgcaactctcgccggtctcggtgttggtgcctcggccgtttaccttcctgaa
gaaggtcttagcttggaaatgctcagcgaagacgtccgtcacttgaaggaggtgttcgct
caggacaagggacagagcagagccggtcgcttgatcctgatcaatgagaaggcctccaag
gtttacaatgccaagctcatcgccgacattctccgcgacgaggcccacggtcgttttgaa
agtcgtgagggtattcccggtcacatgcagcagggtggtgttccctcgggcatggaccgt
tgccgtgctgttcgtttggccatcaagtgcattcagcagcttgagaagtatggacgcaac
gtgcacaaccgcgtcaagatggatcccatgagcgctagcgtcatcggtatcaagggagcg
agtgttatctttacgccggtccagaagttggaggaggaggagaccgactggcccaacaga
cgccccaaggctgccttctggcttagtatgaaggagattgttgacatccttggaggccgt
cctcggcacaccttgcccgagcccgaccttacgggcgtcaaggccaaggacgtgaagcgt
ggactggagccggttgccaattaa

DBGET integrated database retrieval system