KEGG   Neurospora crassa: NCU00743Help
Entry
NCU00743          CDS       T01034                                 

Definition
(RefSeq) glycogen debranching enzyme
  KO
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
ncr  Neurospora crassa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCU00743
Enzymes [BR:ncr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     NCU00743
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     NCU00743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
I
AA seq 1566 aa AA seqDB search
MIPRTMVSNEVYLLPLKDDGSPDVPGEYIYIAPKSKDPVTIRFAIEGTSSICSHGSLWVN
IPEHGEQFQRNKFREFKLVPDFNRTLEISIPIYEAGAYAFYTTYAELPDLASNLVNADGT
VTKATQKKTPLYYIDVAPRLSLDGQPLPLPALSIFSIISKFMGKYPTDWERHLRGISDRG
YNMIHFTPLQVRGASNSPYSLYDQLGWDPACFPAGEPDVQKMVESLEKNHSLLSLTDIVL
NHTAHNSEWLLEHPEAGYNLTTAPWLESAYLLDTKLLELGTRLEELGLPTELKDVDDLVK
IMDAIKKEVIAEIRLWEYYTLDVERDADAAVKSWAANDIDFPQASVGAGGIDSLHSATPK
EQADFLIQHGLQNMDYLGERFRRRANPKVAAALLSAIFGRYEGETKNTADQAAARTKIVE
ILEIVNVPFYKEYDDEVAEILQQLFNRIKYVRLDDHGPKLGPINAENPLIETYFTRLPVN
EKTKKHKKEDLVLANNGWVWGGNALVDNAGPDSRVYLRREVIVWGDCTKLRYGSGPEDSP
WLWEHMTKYARMLAKYFAGFRIDNCHSTPLHVAEHILDEARRVRPDLYVVAELFTGSEEM
DYVFVKRLGISALIREAMQAWSTGELSRLVHRHGGRPIGSFEVDEVSSNEGRSSSISGTN
GDGVYTREVIRRIRPVPVQALFMDCTHDNEVPAQKRDARDTLPNAALVAMCASATGSVMG
YDEIYPKLVDLVGETRLYTSEASKAPVKTGEGKDGIAGVKKLLNQIHTLMGMDGYDETHI
HHEDEYVTVHRVHQESRKGYFLIAHTAFPGYGNGNGAFNPVHLTGTKARHLGSWMLEVDA
SKEAVEEVLSDKKHLRGLPSRLVGLPGVRMEVKGQDTIITVREKFPPGSIALFETWIPAA
EHSSGLDNFVTSGAKAAMDELDLVDLNFLLYKCEPEERDASEGQDGTYDIPGHGKIVYAG
LQGWWSILKDVIKDNNLAHPLCQHLRDGQWALDYIVGRLERASKKDDFRRLAKPAQWLKE
RFDAIRPIPSFLLPRYFGLVLRTAYNAAFERGISLMNNNVIKGQWFLQSLAMVSVQMTGL
VKSASLYPNRLVPSLAAGLPHFAVEWARCWGRDVFISLRGLYLGTGRYAEAREHIHAFAS
VLKHGMIPNLLGSGNNPRYNSRDSVWFFLQCIQDYTRLVPDGLSILDDKVKRRFLPYDDT
YFDVDDERAYSKESTIAEIIQEVFQRHAEGMKYREANAGPNLDMQMSDAGFNQEIKVDWS
NGFIFGGNQANCGTWMDKMGESERAGSKGVPGTPRDGAAVEITGMLYSNLKWAASLNEAG
KFKHSSVRKADGTEITLKDWAALIKDNFERCYFVPISPDEDSKYDVNPAIINRRGIYKDL
YRSGKEYEDYQLRCNFPIAMTCAADLFVPEHAMHALWVADAALRGPTGMATLDPSDMNYR
PYYNNSEDSDDFATSKGRNYHQGPEWLWPTGFFLRALLKFDLMRRGRDDAEGRTEAFQQV
TRRLIGCKEMIQRSPWAGLTELTNKNGEECHDSSPTQAWSAGCLIDLYMDAAEEQAKLEK
HSLPLR
NT seq 4701 nt NT seq  +upstreamnt  +downstreamnt
atgatccccagaaccatggtttccaacgaagtttacctattgccgctgaaggacgatggc
tcgcctgacgtgcctggcgagtacatttacattgcgccaaagtcgaaggatccagtaacc
attcgctttgccatcgagggcacttccagcatctgcagccatggcagcttgtgggtgaac
atccctgagcacggcgagcagttccagcggaacaagttccgcgagttcaagctcgtccct
gacttcaaccgcacactcgagatttcgatcccgatttacgaggctggcgcgtacgccttc
tacaccacatatgccgagctccctgatttggccagcaacctggtcaacgccgacggcacc
gtgaccaaggctactcagaaaaagacaccgttgtactatatcgatgtcgcaccccggctc
tcgctggacgggcagccgctgccacttccggcgctctccatcttctccatcatcagcaag
ttcatgggcaagtatccaacagactgggagcgccatcttcggggaatcagcgaccgaggt
tacaacatgatccacttcacaccgttgcaggtacgaggtgcatcaaattcgccatacagc
ttgtatgatcaattgggctgggacccagcttgcttccccgcaggcgagccggatgtccag
aagatggtggaaagtctggagaagaaccactccctgctcagcttgacggacattgtcctc
aatcacactgcacacaacagcgagtggctcttggagcatcccgaggccggatacaacttg
acgactgcgccatggctcgagtccgcttacctgctcgacaccaagctgctcgagctgggc
accaggttggaggagcttggccttcccaccgagctcaaggacgtcgatgatctggtcaag
attatggatgccatcaagaaagaggtaattgccgagattcgtctctgggagtactatact
cttgatgtggagcgcgatgccgatgccgcggttaagtcctgggctgccaacgacattgac
ttcccacaggcctccgttggagctggaggtatcgactctctacactccgctacccctaag
gagcaggcagatttcttgatccagcatggtctgcagaacatggattatcttggtgagcgc
ttcaggcggagggctaaccccaaggtggctgccgctcttttgtctgctatcttcggccgg
tacgaaggagagacaaagaatactgccgatcaggctgcagccagaaccaagattgtcgag
attctggagatcgtcaacgttccattctacaaggaatatgatgacgaagttgccgagatc
ctgcagcagctgttcaatcgcatcaagtatgtccggctcgatgaccacggcccgaagctc
gggcccatcaacgccgagaatcctctgatcgagacgtacttcactcgtcttcccgtcaac
gagaagacgaagaagcacaagaaggaagacctggttctcgcaaacaacggatgggtatgg
ggcggaaacgcgctggtcgacaatgccggtcccgattctcgtgtctaccttcgccgagaa
gtcattgtctggggagactgcacaaagctccgctacggaagcggtcctgaagacagccca
tggctttgggagcacatgaccaagtacgcccgcatgctggccaaatactttgccggcttc
cgtattgacaactgccattccacgcctcttcatgtcgctgagcacattttggatgaggct
cgtcgtgttcgccccgatctctatgtcgttgcggagcttttcaccggctccgaagagatg
gattacgtctttgtcaagcgtctgggtatcagcgcactcattcgtgaggccatgcaagca
tggagcactggcgagctcagtcgcctggttcatcgtcacggaggtcgacctattggcagc
tttgaagttgacgaggtatcaagcaacgagggccgctcgtcgtccatcagcggcacgaat
ggggatggcgtctacacacgcgaggtcatccgccgtatcaggccggttcccgtacaggca
ctattcatggactgcactcatgacaatgaggttcctgctcagaagcgcgatgcgcgtgac
acgcttccaaacgcagccctggttgccatgtgcgctagcgctaccggcagcgtgatggga
tacgacgagatctatcctaagcttgttgacttggttggcgaaacccgcctttacacgtcc
gaagcttccaaagctcctgttaaaacgggagagggcaaggatggaattgctggtgtgaag
aagcttctcaaccagatccacaccttgatgggtatggatggctatgatgagacgcacatt
caccatgaggacgagtacgtcactgtccacagagtccatcaggagtcaagaaagggctac
ttcctcatcgcacacactgcgttccccggttatggaaacggcaatggcgctttcaaccct
gtccacctgaccggtacaaaggctcgccatctcggtagctggatgctcgaggttgatgcc
agcaaggaagctgttgaggaggtcctgagcgacaagaagcatcttcgtggtcttcccagc
cgtctagtaggtttgccaggcgtgcggatggaagtcaagggccaggataccattatcacc
gtccgcgagaagttccctcctggaagtattgctctctttgagacttggatcccggcggca
gaacactcgagtggtttggacaactttgtcacctctggcgcaaaggcagcaatggatgag
cttgatcttgtcgatctcaacttccttctgtacaagtgcgagcctgaggagcgtgatgct
agcgaaggccaggatggaacctacgacatccctggccacggcaagattgtgtacgctgga
ttgcagggttggtggagcattctgaaggatgtcatcaaggacaacaatctcgcccatcct
ctatgccagcatctccgagacggccagtgggctcttgactacattgttgggagacttgag
cgtgcctcgaagaaagacgactttcgccggctggcgaagcctgctcaatggttgaaggag
cgctttgatgctattcgtcccatcccaagcttcttacttcctagatacttcggtcttgtg
cttcgcacagcctataacgcggcctttgaacgcggtatctcccttatgaacaacaatgtc
ataaaggggcaatggttcctgcagagtttggccatggttagcgttcagatgactggtctg
gtaaaatcagcgtcattgtatcctaaccggctcgtgccgtcgcttgctgcgggtcttcct
cacttcgctgttgagtgggctcgctgctggggtcgcgatgtgttcatttctctccgcggc
ttgtacctcggtactggtcgttacgcagaagccagagagcacatccacgcctttgccagt
gtgctcaagcatggcatgatccctaatcttctaggaagcggcaataaccccagatacaac
tctagagattctgtctggttcttcctgcagtgcatccaggactacacccgtctggttcct
gatggcttgtcgatcctagacgacaaggtcaagcgccgtttcctcccttacgatgacacg
tactttgacgtcgacgatgagcgtgcgtacagcaaggaaagcaccatcgccgagatcatc
caggaagttttccagcgccatgccgagggcatgaagtaccgtgaggccaacgccggcccc
aacttggatatgcagatgagcgatgccggtttcaaccaggagatcaaggttgactggagc
aacggtttcatcttcggcggtaatcaagccaactgcggtacctggatggacaagatgggc
gagagcgagcgtgctggttccaagggtgttccaggaactcccagagacggtgccgccgtt
gagatcacaggtatgctgtacagcaacctgaagtgggcagcttctctcaacgaagccggc
aaattcaagcactctagtgttcgcaaggccgatggtaccgaaatcactctcaaggactgg
gctgctctcatcaaggacaactttgagcgttgctactttgtccccatctcccccgacgag
gactccaagtacgatgtcaacccggcgatcatcaaccgtcgtggcatctacaaggatctc
taccgttccggtaaggagtatgaagactaccagctccgctgcaacttccccattgccatg
acatgcgccgccgacctctttgttccggagcacgctatgcatgctctctgggttgccgac
gccgctctccgtggtcccactggtatggctacgctcgaccccagcgacatgaactacaga
ccgtactacaacaacagcgaggacagcgacgactttgccaccagcaagggtcgcaactac
caccagggtcctgagtggctgtggccgactggtttcttcctccgggcgctgctcaagttt
gacttgatgcgccgcggccgtgacgatgccgagggccgcactgaggcgttccagcaggtc
accaggcgacttataggatgcaaggagatgattcagcggagcccatgggctggacttacg
gagttgacgaacaagaatggagaggagtgtcatgattcgtctcctacccaagcgtggtcc
gccggttgcttgatcgacctctacatggacgctgctgaggaacaagccaagcttgagaag
cactcgcttcccttgagatag

DBGET integrated database retrieval system