KEGG   Neurospora crassa: NCU00762Help
Entry
NCU00762          CDS       T01034                                 

Definition
endoglucanase 3 precursor
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ncr  Neurospora crassa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ncr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 390 aa AA seqDB search
MKATILASTFAAGALAQSGAWGQCGGNGWSGATSCISGYACNYVNDWYSQCQPGTAAPTT
TAAATTLVTSTKTAPPASTTTATASGKFKWFGVNEAGGEFGDGIFPGRWGTEFTFPDTNT
IQTLRSQGYNIFRVGFAMERLVPNTLTSSFDNGYLTNLTQVVNSVTNSGAYIVLDPHNYG
RYYGKIITDTDAFKTFWQNVAAKFASNSKVIFDTNNEYNTMDQTLVLNLNQAAIDGIRAA
GATSQYIFVEGNQWTGAWSWNVTNTNLAALTDPENKIVYEMHQYLDSDSSGTSTACVSSE
IGVQRIVGATAWLRANGKKGVLGEFAGGANSVCKAAVTGLLEHLKANTDVWEGALWWAAG
PWWGDYMYSFEPPSGTGYTYYNSLLKTYTP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctacgattcttgccagcaccttcgccgctggtgccctcgcccagagcggtgcc
tggggccaatgcggcggtaacggttggtccggcgctaccagctgcatctccggatacgcc
tgcaactacgtgaacgattggtatagccagtgccagcctggtactgccgctcctaccacc
actgccgccgccaccaccctcgtcacctcgaccaagaccgcccctcctgctagcaccacc
actgccaccgcctccggcaagttcaagtggttcggtgtcaacgaggccggcggtgagttt
ggtgatggtatcttccccggaagatggggcactgagttcacattccctgacaccaacacc
atccagactctccgcagccagggttacaacatcttccgtgttggcttcgccatggagcgc
cttgtccccaacaccctgacgtcgtctttcgataacggctatctcaccaacctcacccag
gttgtcaactctgttaccaactctggtgcctatattgttctcgatccccacaactatggc
cgttactatggcaaaatcatcaccgataccgatgccttcaagactttctggcaaaatgtt
gctgccaagtttgcttccaactccaaggtcatcttcgataccaacaacgagtacaacacc
atggaccagacccttgtcctcaacctcaaccaggccgccattgacggtattcgtgcggcc
ggcgccacttcgcagtacattttcgtcgagggtaaccaatggactggcgcctggtcatgg
aatgtgaccaacaccaatttggctgcccttaccgatcccgagaacaagatcgtctacgag
atgcaccagtacctcgactccgatagctccggtaccagcactgcctgcgtttcctccgag
atcggtgttcagcgcattgttggtgccactgcctggctccgcgccaatggcaaaaagggt
gtcctcggcgagttcgctggtggtgccaactcagtctgcaaggctgccgttactggcctt
cttgagcacctcaaggctaacactgacgtctgggagggtgccctttggtgggctgccggt
ccctggtggggtgactacatgtatagctttgagcctccttcgggcactggctatacctac
tacaacagccttctcaagacctataccccttaa

DBGET integrated database retrieval system