KEGG   Neurospora crassa: NCU00762Help
Entry
NCU00762          CDS       T01034                                 

Gene name
gh5-1
Definition
(RefSeq) glycosylhydrolase family 5-1
  KO
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ncr  Neurospora crassa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCU00762 (gh5-1)
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     NCU00762 (gh5-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 390 aa AA seqDB search
MKATILASTFAAGALAQSGAWGQCGGNGWSGATSCISGYACNYVNDWYSQCQPGTAAPTT
TAAATTLVTSTKTAPPASTTTATASGKFKWFGVNEAGGEFGDGIFPGRWGTEFTFPDTNT
IQTLRSQGYNIFRVGFAMERLVPNTLTSSFDNGYLTNLTQVVNSVTNSGAYIVLDPHNYG
RYYGKIITDTDAFKTFWQNVAAKFASNSKVIFDTNNEYNTMDQTLVLNLNQAAIDGIRAA
GATSQYIFVEGNQWTGAWSWNVTNTNLAALTDPENKIVYEMHQYLDSDSSGTSTACVSSE
IGVQRIVGATAWLRANGKKGVLGEFAGGANSVCKAAVTGLLEHLKANTDVWEGALWWAAG
PWWGDYMYSFEPPSGTGYTYYNSLLKTYTP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctacgattcttgccagcaccttcgccgctggtgccctcgcccagagcggtgcc
tggggccaatgcggcggtaacggttggtccggcgctaccagctgcatctccggatacgcc
tgcaactacgtgaacgattggtatagccagtgccagcctggtactgccgctcctaccacc
actgccgccgccaccaccctcgtcacctcgaccaagaccgcccctcctgctagcaccacc
actgccaccgcctccggcaagttcaagtggttcggtgtcaacgaggccggcggtgagttt
ggtgatggtatcttccccggaagatggggcactgagttcacattccctgacaccaacacc
atccagactctccgcagccagggttacaacatcttccgtgttggcttcgccatggagcgc
cttgtccccaacaccctgacgtcgtctttcgataacggctatctcaccaacctcacccag
gttgtcaactctgttaccaactctggtgcctatattgttctcgatccccacaactatggc
cgttactatggcaaaatcatcaccgataccgatgccttcaagactttctggcaaaatgtt
gctgccaagtttgcttccaactccaaggtcatcttcgataccaacaacgagtacaacacc
atggaccagacccttgtcctcaacctcaaccaggccgccattgacggtattcgtgcggcc
ggcgccacttcgcagtacattttcgtcgagggtaaccaatggactggcgcctggtcatgg
aatgtgaccaacaccaatttggctgcccttaccgatcccgagaacaagatcgtctacgag
atgcaccagtacctcgactccgatagctccggtaccagcactgcctgcgtttcctccgag
atcggtgttcagcgcattgttggtgccactgcctggctccgcgccaatggcaaaaagggt
gtcctcggcgagttcgctggtggtgccaactcagtctgcaaggctgccgttactggcctt
cttgagcacctcaaggctaacactgacgtctgggagggtgccctttggtgggctgccggt
ccctggtggggtgactacatgtatagctttgagcctccttcgggcactggctatacctac
tacaacagccttctcaagacctataccccttaa

DBGET integrated database retrieval system