KEGG   Neurospora crassa: NCU00776Help
Entry
NCU00776          CDS       T01034                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
ncr  Neurospora crassa
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    NCU00776
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NCU00776
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     NCU00776
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 542 aa AA seqDB search
MSTDIKFAITGAVPLRRELRDLQQNYPEQFNLYLLGLRDFQGLDEAKLDSYYQVAGIHGM
PFKPWAGVPSDTDWSQPGSSGFGGYCTHSSILFITWHRPYLALYEQALYASVQAVAQKFP
VEGGLRAKYVAAAKDFRAPYFDWASQPPKGTLAFPESLSSRTIQVVDVDGKTKSINNPLH
RFTFHPVNPSPGDFSAAWSRYPSTVRYPNRLTGASRDERIAPILANELASLRNNVSLLLL
SYKDFDAFSYNRWDPNTNPGDFGSLEDVHNEIHDRTGGNGHMSSLEVSAFDPLFWLHHVN
VDRLWSIWQDLNPNSFMTPRPAPYSTFVAQEGESQSKSTPLEPFWDKSAANFWTSEQVKD
SITFGYAYPETQKWKYSSVKEYQAAIRKSVTALYGSNVFANFVENVADRTPALKKPQATG
EESKSTVSAAAAHAVELSGAKKVAEKVHNVFQHAEEKAQKPVVPVKDTKAESSTAAESLK
YLAPDGKYTDWIVNVRAQKHGLGQSFRVIVFLGEFNPDPETWDDEFNCVGRYCGRRAPEP
QA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgacatcaaatttgccatcacgggagcggtccctctccgccgcgagctccgc
gacctccaacaaaactacccggagcagttcaatctctacctcctcggcctgcgcgacttc
caaggcctcgacgaagccaagctagactcgtactaccaagtcgctggcattcacggtatg
cccttcaagccgtgggccggtgtcccttccgacacggactggtcccaacccggcagcagc
ggctttggcggctactgcacgcactcgtccatcctcttcatcacctggcacaggccctac
cttgctctgtacgagcaggccctctacgcctccgtgcaagccgttgcccaaaagttccct
gtcgaaggggggctgagagccaagtatgtcgcggccgccaaggatttcagggcgccgtac
tttgattgggctagtcagcctcctaaaggaacgctggcgtttccggagtccctctcatcg
cgtaccatacaggtggtggatgtcgacgggaagaccaagagcatcaacaacccgctgcac
cggtttactttccacccggtcaaccctagccctggtgacttcagcgcggcgtggagcaga
tacccaagcacggtccggtatccaaaccggctgacaggggcatcgcgggatgagcggatt
gcgcccatcttggcgaacgagctggcgtcattgagaaataatgtcagtttgttgttgctg
agctacaaggactttgatgcgttcagttataacaggtgggatccgaataccaacccgggt
gatttcggcagtttggaggatgtgcataatgagattcatgatcggacaggcggaaatgga
catatgtcgagcctggaggtgtcggcttttgatccgctgttttggttgcaccatgttaac
gtcgaccgcctctggtctatctggcaagaccttaaccccaacagcttcatgactccccga
cccgctccctactcgaccttcgtcgcacaggagggtgaaagccagagtaagagcacgcct
ctggagccgttctgggacaaatctgctgccaacttttggacctctgagcaggtcaaggac
agcatcaccttcggatacgcgtatcctgagacgcagaagtggaagtactcgtccgtaaag
gagtaccaggcagccatcaggaagtctgtcacggcgctgtacgggagcaatgtgtttgcc
aactttgttgagaatgtcgccgaccgaacgccggcgttgaagaaaccgcaggcaactggc
gaggagagcaagagcaccgtctcggctgctgctgctcatgcagttgagctttccggggcc
aagaaggtcgcagagaaggtccataatgtgttccagcacgctgaggagaaggcgcagaag
ccggtggtgcctgttaaggatacaaaggccgagtcgagcacggccgcagagagcctcaag
tacctcgccccagacggaaagtacaccgactggattgtcaacgttcgcgcccagaaacac
ggtctggggcaatccttccgtgtcatcgtcttcttgggcgagttcaaccccgacccagag
acctgggacgacgagttcaactgcgtcggtcgatattgtgggcggcgagctccagagcct
caagcctga

DBGET integrated database retrieval system