KEGG   Neurospora crassa: NCU00776Help
Entry
NCU00776          CDS       T01034                                 

Gene name
T
Definition
(RefSeq) tyrosinase
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
ncr  Neurospora crassa
Pathway
ncr00350  Tyrosine metabolism
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    NCU00776 (T)
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     NCU00776 (T)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase
Motif
Other DBs
NCBI-GeneID: 3881081
NCBI-ProteinID: XP_964932
UniProt: P00440
Position
I
AA seq 676 aa AA seqDB search
MSTDIKFAITGAVPLRRELRDLQQNYPEQFNLYLLGLRDFQGLDEAKLDSYYQVAGIHGM
PFKPWAGVPSDTDWSQPGSSGFGGYCTHSSILFITWHRPYLALYEQALYASVQAVAQKFP
VEGGLRAKYVAAAKDFRAPYFDWASQPPKGTLAFPESLSSRTIQVVDVDGKTKSINNPLH
RFTFHPVNPSPGDFSAAWSRYPSTVRYPNRLTGASRDERIAPILANELASLRNNVSLLLL
SYKDFDAFSYNRWDPNTNPGDFGSLEDVHNEIHDRTGGNGHMSSLEVSAFDPLFWLHHVN
VDRLWSIWQDLNPNSFMTPRPAPYSTFVAQEGESQSKSTPLEPFWDKSAANFWTSEQVKD
SITFGYAYPETQKWKYSSVKEYQAAIRKSVTALYGSNVFANFVENVADRTPALKKPQATG
EESKSTVSAAAAHAVELSGAKKVAEKVHNVFQHAEEKAQKPVVPVKDTKAESSTAAGMMI
GLSIKRPSKLTASPGPIPESLKYLAPDGKYTDWIVNVRAQKHGLGQSFRVIVFLGEFNPD
PETWDDEFNCVGRVSVLGRSAETQCGKCRKDNANGLIVSGTVPLTSALLQDIVGGELQSL
KPEDVIPHLRANLKWKVALFNGDEYNLEEVPDLKVSVASTEVTIDEEGLPHYSRQYTVYP
EITEGKPCGHGPEDHI
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgacatcaaatttgccatcacgggagcggtccctctccgccgcgagctccgc
gacctccaacaaaactacccggagcagttcaatctctacctcctcggcctgcgcgacttc
caaggcctcgacgaagccaagctagactcgtactaccaagtcgctggcattcacggtatg
cccttcaagccgtgggccggtgtcccttccgacacggactggtcccaacccggcagcagc
ggctttggcggctactgcacgcactcgtccatcctcttcatcacctggcacaggccctac
cttgctctgtacgagcaggccctctacgcctccgtgcaagccgttgcccaaaagttccct
gtcgaaggggggctgagagccaagtatgtcgcggccgccaaggatttcagggcgccgtac
tttgattgggctagtcagcctcctaaaggaacgctggcgtttccggagtccctctcatcg
cgtaccatacaggtggtggatgtcgacgggaagaccaagagcatcaacaacccgctgcac
cggtttactttccacccggtcaaccctagccctggtgacttcagcgcggcgtggagcaga
tacccaagcacggtccggtatccaaaccggctgacaggggcatcgcgggatgagcggatt
gcgcccatcttggcgaacgagctggcgtcattgagaaataatgtcagtttgttgttgctg
agctacaaggactttgatgcgttcagttataacaggtgggatccgaataccaacccgggt
gatttcggcagtttggaggatgtgcataatgagattcatgatcggacaggcggaaatgga
catatgtcgagcctggaggtgtcggcttttgatccgctgttttggttgcaccatgttaac
gtcgaccgcctctggtctatctggcaagaccttaaccccaacagcttcatgactccccga
cccgctccctactcgaccttcgtcgcacaggagggtgaaagccagagtaagagcacgcct
ctggagccgttctgggacaaatctgctgccaacttttggacctctgagcaggtcaaggac
agcatcaccttcggatacgcgtatcctgagacgcagaagtggaagtactcgtccgtaaag
gagtaccaggcagccatcaggaagtctgtcacggcgctgtacgggagcaatgtgtttgcc
aactttgttgagaatgtcgccgaccgaacgccggcgttgaagaaaccgcaggcaactggc
gaggagagcaagagcaccgtctcggctgctgctgctcatgcagttgagctttccggggcc
aagaaggtcgcagagaaggtccataatgtgttccagcacgctgaggagaaggcgcagaag
ccggtggtgcctgttaaggatacaaaggccgagtcgagcacggccgcaggtatgatgatc
ggcttgagcataaaacgtccatccaagctgacagcttcaccaggcccaattccagagagc
ctcaagtacctcgccccagacggaaagtacaccgactggattgtcaacgttcgcgcccag
aaacacggtctggggcaatccttccgtgtcatcgtcttcttgggcgagttcaaccccgac
ccagagacctgggacgacgagttcaactgcgtcggtcgtgtgtccgtgttgggacggagc
gccgaaacccagtgtggcaagtgccgcaaggataacgcaaacggtctgatcgtctcaggc
actgtgcccctgacctccgctttgctgcaggatattgtgggcggcgagctccagagcctc
aagcctgaggatgtcatcccgcatctgcgcgccaacttgaagtggaaggtggccctcttc
aacggcgacgagtataatctggaggaggttccggacctcaaggttagtgtggcttcgaca
gaggtgactatcgatgaggaaggcttgccacattactctcgccagtataccgtctatcct
gagatcaccgaggggaagccgtgcggacatggcccagaggatcacatctaa

DBGET integrated database retrieval system