KEGG   Neurospora crassa: NCU00813Help
Entry
NCU00813          CDS       T01034                                 

Definition
similar to disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ncr  Neurospora crassa
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NCU00813
Enzymes [BR:ncr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NCU00813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 504 aa AA seqDB search
MHHSTLCALAVGILSALPGAQAGLYTKKSPVLQVDGKDYDRLIAKSNQTSILEFYAPWCG
HCQNLKPAYEKAAKNLEGLAKVAAVNCDEDANKPFCGSMGVQGFPTLKIIRPSKNGKPIV
EDYQGQRTASAIVDAVVSRINNHVVKVEDKNLDKFLSDKNETAKALLFTDKGTTSPLLKS
VAIEFLGVMPVGQVRNTQSKAVSTFGVDKLPTLILLPGGDAPGIVYDGEINKAAMVEFLS
QAAQPNPDPAPANGKTNGKTNGKTNGKANGKANGKANGKANGGEKNGKQDSKKVASSETS
SETSSETPAPTQEIPVIIHTALPIPSLNTPEKLVKECLTSKSSTCLLALVSSSNEKAQKA
LTHLAEIKFKYALGQHKLFPFYEVPLDTNPAGASLLKSLGLKEDADIELIVINARRGWWR
RYDAVGEGDDFSDHDKVEAWIDAIRLSEGTKKKLPEGIVVEASSTEEEEKKKEKKESGKA
EKAASKEGETPEAQSKTASGHDEL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcatcattccaccctctgtgctctggcagttggtatcctgtctgcgctccccggagcc
caggcgggcctttataccaaaaagtccccagttttgcaggttgacggaaaggattacgat
agattgattgccaagagcaaccagacgtctattcttgagttctacgccccctggtgcggc
cactgccaaaacctcaagcccgcctacgaaaaggctgccaagaacctcgaaggcctggcc
aaggtcgccgccgtcaactgcgatgaggacgccaacaagcccttttgcggcagcatgggc
gtgcagggcttcccgaccttgaagatcatccgtccttctaagaacggcaagcccatagtg
gaggactaccaaggccagcgcaccgccagcgcaattgtcgatgctgtggtctcgcgcatc
aacaatcacgtcgtgaaagtcgaggacaagaacctcgacaagttcctgagtgacaagaac
gagacagccaaagcgctcctcttcaccgacaagggtaccacctcccccttgctgaagagc
gtcgccattgaattcctcggtgtcatgcccgtcggtcaggtgcgaaacactcagtccaag
gcggtatccacattcggtgtcgacaaactccctactctgatcttgttgcctggcggtgat
gcccctggtattgtgtacgacggcgagatcaacaaggccgccatggtggagttcctttcc
caggcggcccagcctaatccggacccagcaccggccaacggcaagactaatggcaagact
aatggcaagactaatggcaaggctaatggcaaggctaatggtaaggccaacggcaaggcc
aacggtggtgaaaaaaacggaaagcaagactccaagaaggtcgcctcctccgaaacctcc
tctgaaacgtcctccgaaacccctgccccaacccaagagattcccgtaataatccacacc
gccctccccatcccctccctcaacacccccgaaaagctcgtcaaggaatgcctcacgtcc
aaatccagcacctgccttctcgcgctggtatcctcttccaacgaaaaagcccaaaaggcc
ctcacccacctcgccgaaataaaattcaaatatgccctcggccaacacaagctcttcccc
ttttacgaggtgcccctcgacaccaaccccgccggcgcgtcccttctcaaatcccttggc
ctcaaggaggatgctgacattgaactcatcgtcatcaacgcccgtcgcggatggtggaga
cgctacgacgctgttggtgagggagatgatttctcggatcatgacaaggtggaggcgtgg
attgatgcgattaggttgagcgagggcaccaagaaaaagctgccggagggtattgttgtt
gaggcttcttcgacggaggaggaggagaagaagaaggaaaagaaagagtctggtaaggct
gagaaggctgcttcaaaggagggggagacgcctgaggcccagtcgaagacggccagtggt
cacgatgagctgtga

DBGET integrated database retrieval system