KEGG   Neurospora crassa: NCU00978Help
Entry
NCU00978          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ncr  Neurospora crassa
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    NCU00978
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     NCU00978
Protein kinases [BR:ncr01001]
 Serine/threonine protein kinases: Other group
  TTK family
   NCU00978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 918 aa AA seqDB search
MSSISPTPMGGGSHFTSMGRRTSARQALRRPPSRPMLNRSESNPQSQSQQYSNLNDSSDD
EIPVPMKLSALTKALLNDGHASEASSFAQHGAPEDLQLSPPARPPSRVTRRSALLSSKSE
ERSEGVRAREARRSIRGGSLQPMDRPTSPVQNDSSNNRDGSPVPRKRVVRLSNPVQGPVS
FSGNVRRLSSTTANQRRTRTESREREVEKEIPSFLQQQGDAGSDSAGDAQTPVIRTVRIA
VGSGSSGSKGRISLGGGGGSSGSSFAGVSGKRGTGYSDHENPEDPATIGRPQTVAPQSSM
RIKRVAKLPGSFLSGPARRGRRRQSDEDEAAHGENEGMGMNQDNDGNYESHMQSHVEAAM
GEQHLSFYGSNNNYRDYAASGSPVSGKAGAVRRRESNFRTMERDNGELGYKIAEPHPDMP
MNNDKENEAPPTFKRAKLTPSAMLDHEIPKPVIPEPMALDIGRDIGRDLKRLSISPDRKA
LAHKSQNTPHRPAPPPPPKMSVVETATAAAGASATAGAAKKRQVLLRVNGRTYTRIDCIG
RGGSGKVYRVSAESGKMLALKRVSLEHADENTVKGFKGEIDLLKRLNGVERVIQLIDHEL
NLEKQVLSVLMEVGELDFNTLLKSRQSTAEGARLDPTFIRYYWKEMLECVQAVHARDVVH
SDLKPANFVLVQGRLKLIDFGIANAIQTEMTVNVHRETQIGTPNYMSPESLMDSNQYAFT
SAQNGKFCIPPPLNHRQHGAPKLMKLGKPSDVWSLGCILYQMVYGLPPFGKIANQMSRCQ
AIINWSYQIDFPEATEDGSRVPPSVIRTMRRCLNREQRERPTCDELLADTDPFLYPQEFD
PSVYAAAEHGRVLPVTEELLSRLIQSVVQRCKERMPTEAEVVNTWPQAYWATVRKAVMGA
GNNAGGSGGGNGSGGHQR
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatttcgccaacgcccatgggcggtggaagccactttacgtctatgggaaga
aggacatccgctagacaagctttgcgacgtcccccatcgcggcccatgctcaatcgcagc
gagtcgaatccccagtcgcaatctcaacagtattccaacctcaacgacagctcggacgac
gagatccccgtacccatgaaactcagcgccttaaccaaggctctgcttaacgacggccat
gcatccgaagcctcatcttttgcgcaacatggcgctccagaggatctgcagttatcaccc
ccagctcgaccaccatcacgcgttactagaagaagcgcgttgttgtcgtcaaagtcggag
gaaaggtcggaaggtgtgagggcgcgggaagcgaggcggagtatcagaggaggaagcctg
cagcccatggacaggccgacgtcgccagtccagaacgacagcagcaacaaccgcgatggc
agcccggtacctaggaaacgagtggtccgcctcagcaatcccgtgcagggtccagtcagt
ttttcaggaaatgtccggagactctcatcgacgacggcaaaccagaggagaaccaggacg
gagagcagggaaagagaggtcgagaaagaaattccatcgtttctacagcagcaaggagat
gcaggatcagattcagcgggagatgcccaaacgcccgtgatcaggacggtcaggattgcg
gtgggctctgggtcttcaggcagcaagggtcggatttctctagggggaggaggagggtcg
tcgggtagttcgttcgccggtgtttccgggaaacgcggcacaggatatagtgatcacgag
aatcccgaggatcctgcaaccattggaaggccacaaacggtagcaccacaaagctcaatg
cgtatcaagagagtcgcaaagcttccagggagctttctcagcggcccagcgcggcgaggg
cggagaaggcagagcgatgaggacgaggcagcacatggagaaaacgaaggtatgggcatg
aaccaagacaacgatgggaattacgagagccacatgcagagccatgtcgaagccgctatg
ggcgagcaacatttgtcgttctacgggtccaacaataactatcgcgattatgccgcatcc
ggaagtcctgttagcggcaaagccggagcggttcgcaggcgagaatccaacttcagaacg
atggaaagagataacggggaactgggttacaagatcgctgagcctcatccagatatgccc
atgaacaacgacaaggagaacgaggcaccgccgaccttcaaaagggccaagctgaccccg
tccgcaatgctcgatcacgagatcccgaaaccggttatccccgaaccaatggccctcgac
attgggcgcgacatcgggcgagatcttaagaggctttcgatttcacccgaccgcaaagcg
ctggcgcataagagtcagaatacaccgcacaggccggcgcctccacctccaccaaagatg
tcagttgtcgagactgcaacagctgcggctggagcttctgcgactgctggggcggccaag
aaaaggcaggtccttttgcgagtgaacggccgaacatacacccgcattgactgtattgga
cgaggtggttctggcaaggtttatcgtgtttccgctgagagtgggaagatgttggccttg
aagagggtgtctctcgaacatgccgacgaaaacaccgtgaagggattcaagggcgagatt
gatttgctgaaacgtttgaatggtgtggaacgggtcattcaactcatcgaccatgagctg
aatctggagaagcaggtactcagtgtgctcatggaagtaggcgaactcgatttcaacacg
cttcttaaaagccgccaaagcaccgcagaaggcgctcgtctcgatccaaccttcattcgg
tattactggaaagagatgctcgaatgcgtgcaagccgtgcacgcccgcgacgttgtgcac
agtgatctcaagccggccaactttgtccttgtccagggccgcctcaagctcatcgatttc
ggcatcgccaacgccatccagaccgaaatgacagtcaacgtgcaccgagaaacgcaaatc
ggcacgcccaactacatgtcgcccgaatctctgatggactcgaaccaatacgccttcacg
tccgcccagaacggcaagttctgcatcccgccgccgctgaaccaccgccagcacggcgcg
cccaagctcatgaagctcggcaagccctcagacgtctggtcgctcggctgcatcctgtac
cagatggtgtacggcctgccgccctttggcaagattgccaaccagatgtcgcgatgccag
gccatcatcaactggtcgtaccagatcgattttccggaagccaccgaggacggcagccgc
gtgcccccctcggtcatccgcaccatgcgccgatgtctcaaccgcgagcagcgcgagcgc
cccacgtgcgacgagctactggctgacacggacccgttcctgtacccgcaggagttcgat
ccgtcagtgtacgcggcggcggagcatggtagggtcctgcctgtcacagaggagctattg
tcgaggcttatacagagtgtggtgcagagatgcaaggagaggatgcccacggaggcggag
gtggtgaatacttggccgcaggcgtactgggcgactgtgaggaaggcggtcatgggtgcc
ggtaataatgctggtggaagtggaggtgggaatggtagtggcggccaccagaggtga

DBGET integrated database retrieval system