KEGG   Neurospora crassa: NCU01067Help
Entry
NCU01067          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
ncr  Neurospora crassa
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ncr03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ncr03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 427 aa AA seqDB search
MASEDARYRETSQFQAWSFSPAQLAAMREKTNAIARQRIAERMLASASNPPTSNNTSHAN
TPDPSGHGTPNPTENSTPTLPDFLKPEEEALLVSFYVSELLRAADHLGVPDEVRATATVF
FRRFFLTNSIMTYPPQEMILVALFVGSKAEGRFPRIIEFQQKFNTKQDILAGEFLLCQGN
RFNFEVRHPFRALMGATMELRSYGDIDEQRIIAAEKRAHEILLFSPLMTDAYFHYTPSQI
MFAALSLADRGLAERLIQETFHFVPPTTNNDNTPAVTPLPGLENQGIGRKEGGSKGITTN
DERAAIVGPGIRDKVMGTIEACRNMLSTELPERKSHWTSESIFKSQIRPVRKKLTKCRDP
DRWNLSELQRQRREAGVRRADSEERPAASNGSKDAAIFGGDLSADAPEKKRRKVDGNGLE
DPFGGPL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgaagacgcacgataccgcgaaacctcgcagtttcaagcatggtccttctcg
cccgcccagcttgctgccatgcgcgagaaaaccaacgccatcgcccgtcaaagaatagcc
gagcgcatgctggcatccgcctcgaatccgccgacttcgaataacacatcccatgcgaac
actccagatccgtctggacatgggactcccaaccccaccgagaacagcacaccaacctta
cccgacttcctcaaacctgaagaagaggccttacttgtgtccttttacgtatccgaatta
ttgcgcgcggcggaccatcttggagttccagacgaagtcagggcgacagcaacggtcttt
ttcaggaggttcttcctgacgaatagcatcatgacgtacccaccacaggagatgatactt
gtggcgttgtttgtgggaagtaaggcggagggaaggtttcctcggattattgagtttcag
caaaagttcaatacgaagcaggatatcctcgctggcgagtttttgctttgccagggcaac
aggttcaactttgaggtcagacacccgtttagggcgttgatgggagcgacgatggagttg
aggagttacggggacatcgacgaacaacgcatcatagcagccgaaaagcgtgctcacgag
atcctgctcttcagtcctctcatgaccgatgcctactttcactacacaccatcgcagatc
atgttcgcagcactatcccttgccgaccgcggactggctgagcgcctgattcaggagact
ttccactttgtcccgcccactaccaacaacgataacacccctgccgtgacaccactacct
ggtttggagaatcaggggataggccgaaaggagggtggtagcaaggggataacgaccaac
gatgagcgcgcagccatagtcggcccagggatccgagataaggttatgggcactatcgag
gcatgcaggaacatgctgtccaccgaactgccggagaggaagtcgcattggacgagtgaa
tcaattttcaaatcccaaatccggcccgtccgcaagaagttgacgaagtgtcgcgacccc
gatcgctggaatttgtctgagcttcagcgccaacgccgagaggcaggagtcagacgtgcc
gattcagaggagcgccctgcagccagcaacgggtccaaggacgccgctatctttggcggc
gatctgtcagccgatgcgccggagaagaagaggaggaaggttgatgggaatgggctggaa
gatccttttggcggcccgctttga

DBGET integrated database retrieval system