KEGG   Neurospora crassa: NCU01229Help
Entry
NCU01229          CDS       T01034                                 

Definition
similar to histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NCU01229
Transfer RNA biogenesis [BR:ncr03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    NCU01229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 571 aa AA seqDB search
MATTTVTVTRSKKNANLPSENDRFLRCCADIANALIEDHEAAQNGRPQKDINLNSLRSKF
AKKHKINNVPPLTAIIAAVPEHYKKYILPRLIAKPIRTSSGIAVVAVMCKPHRCPHIAYT
GNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQLKSLGHSVDKV
EYIIMGGTFMSLPESYRDEFISQLHNALSGYGTLNVDEAVRSGEQSNIKCVGITIETRPD
YCLQPHLSSMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFCLAKDAGFKVVSHM
MPDLPNVGMERDLDQFREYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYQNYTPNGL
IDLVARIMALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTTCRDVRTRE
VGVNEVKNKIRPNQIELVRRDYTANGGWETFLAYEDPKQDILVGLLRLRKCSEKYTFREE
LVGQPTSLVRELHVYGMAVPLHVRDPRKFQHQGFGTLLMEEAERIARDEHGSVKISVISG
VGVRSYYRKLGYWLDGPYMSKWLDGRPGPEE
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaacaacggtcacagtcactcgcagcaagaagaatgcaaacttgccgtccgaa
aacgacaggttcttgagatgttgcgccgacatcgcgaacgccctcatcgaagatcatgaa
gccgctcaaaacggccgtccgcaaaaggacattaatctcaacagccttcgatccaagttt
gcgaagaaacacaaaatcaacaacgtccccccactaaccgctattatcgccgctgttccc
gaacattacaagaagtacatcttgcccagactcatcgccaagcccatcagaacctcgtcg
ggtatcgctgtagtggctgtcatgtgcaagccccatcgatgcccccatattgcgtatacc
ggcaatatttgcgtctactgccccggtggtccagactccgacttcgaatacagcacacag
tcatacacgggatatgagccgacatcgatgagagccatccgggctcgttacgaccccttc
gagcaggcgagaggacgagttgatcagctaaagtcattgggccactcggtcgacaaggtc
gaatacatcatcatgggcggcactttcatgtcgctccctgaatcatacagagacgagttt
atttcccagctacacaacgccctgagcggctacggaaccttgaacgtggacgaggctgtg
aggtcgggagaacagagcaacatcaagtgcgtgggtattacgatagagactagaccggat
tactgccttcagccccatctttcgagcatgctgcgctacggctgcacccgtctcgaaatt
ggggttcaatccctttacgaagatgttgcccgcgataccaaccgtggtcacaccgttgct
gccgtcgccgaaaccttttgcctcgccaaggatgccggtttcaaggtggtcagccacatg
atgcctgaccttccgaacgtcggcatggagagagatcttgaccagttccgggagtacttt
gagaacccagcttttcgtaccgacggtctcaagatctatcctacccttgtcatccgtgga
acgggcctttacgagttgtggaggacaggcaggtatcaaaactacacacccaacggattg
atcgacctcgtggcaaggataatggccctcgttcccccctggactcgcatctaccgcgtc
cagcgtgatatccccatgccgctggtgacgtccggtgtcgagaacggtaatctgcgtgag
ctggctttggcgcgtatgaaggactttggaaccacctgccgcgatgtgcgcactcgtgaa
gttggtgttaacgaggtcaagaacaagatcaggcctaatcaaatcgagctcgtccgtcgc
gactacaccgccaacggcggctgggagactttcctcgcctacgaggatcccaagcaggac
atcttggtcggtctgctccgcctgcgtaagtgttcggaaaagtacacgttccgcgaggag
ttggttgggcagcccaccagtctggtccgcgagttgcacgtttacggcatggctgtacct
ttgcacgtcagagacccgaggaaattccagcatcaaggtttcggtacgcttctcatggag
gaggccgagaggattgcgagagacgagcacggaagtgtgaagatcagcgttatttctggt
gtcggtgtgcgtagctactataggaaactcgggtattggctcgatgggccttacatgtcc
aagtggctcgatggcaggcctggacctgaggagtag

DBGET integrated database retrieval system