KEGG   Neurospora crassa: NCU01266Help
Entry
NCU01266          CDS       T01034                                 

Definition
similar to phosphoinositide-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ncr  Neurospora crassa
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ncr00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ncr04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 769 aa AA seqDB search
MAFNEKAVHEFWQRQMRKKYADRVIPAEGETIELPDIERICRSLHMHLSPTEIRDNFNAA
KAAKATSNGVCDPTSPSSLNFNEFKEFVRLLKARSEISHVFKNHTTNPKAGMTRQEFIQF
LKEIQCEDVEEDSTHWNNIFSQFARRRRSKDAEQTISGDESLTISEAGFTGFLNSHFNSL
LIQEPSEYVLDRPMNEYYISSSHNTYLLGRQVRGISSVEGYISALERGCRCVEVDCWDGP
NDEPYVSHGHTWTTRIKFEEVIKTINKYAFVKSRFPLWISLEVRCNAATQANMAKIMIDI
FGDKLVRAPLDPSSDRLPSPSDLIERILIKVKKSQPVPNTPSEESLKTERPGRRRGNSLP
SPYQRPSPLPSPMDNTSVAVPGSPSLSPSPMLRATRQINTITEGEVHSHGGPSNSPSEYE
SDAEKDSGKKVVSKINPILGELGVYCMGVHFDGFDSPDAKKFNHIFSFKEKTFAERSQPG
EAKRALYRHNMRYLMRVYPNGGRISSSNFDPLLYWKRGVQMAALNWQTFDLGMQLNQAMF
DSGTDLSGYVLKPLEGRQIQVVPTDAAGQLSGKRPRKRISFKIEVISAQQLMRPLNLPKG
RTLDPYVEVEIFLADDKRNKQDGATNAPAQETQLKYRTDIVKDNGFNPVFKGNNSYEFIV
TTKYPDLIFVRWSVKLGDNKGYNDRSPPLATFTAKLGGLKQGYRTIPLLDHNGYNYLFST
LFCKITKSQPTDIMVTYSSEVPRNSVSRIKNIFNQSGISPKSSMDSGRA
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggccttcaacgaaaaggccgtccacgagttctggcaacgacaaatgagaaagaagtac
gcagatagggtcattccggctgaaggcgaaaccattgaacttcccgacattgagagaatc
tgtcgctctcttcacatgcacctatcgccgacagaaattcgcgacaactttaacgctgct
aaagctgccaaggctacctccaacggggtctgtgatcccacttccccttccagtttgaac
ttcaacgagtttaaagagttcgtgcggctattgaaggcgaggtctgagatcagccatgtc
ttcaagaatcatacgaccaaccctaaagcagggatgacgaggcaagaattcatacaattc
ttgaaggagattcaatgcgaagacgtggaggaagattctacgcattggaacaatatcttc
tctcagttcgcgcgtagacgcaggtccaaagatgccgagcagaccatcagcggggatgag
tcattgaccatatctgaggctggcttcactggatttctcaattcacatttcaacagtttg
ctcatccaggagccatccgaatatgttctcgaccgaccaatgaatgagtattatatctca
agctcacataatacatatcttcttggtcgccaagtccgtggaatctccagtgtcgaaggc
tatatttcggcacttgagcgtggttgcagatgcgttgaagtcgactgctgggacggcccg
aatgacgagccttatgtgtcacacggccatacctggaccacaaggatcaagtttgaagag
gtgatcaaaaccatcaacaagtatgcctttgtcaagtctcgctttcctctctggatatcg
ctggaggtccgctgtaacgctgcgactcaagccaacatggcaaagattatgattgacata
ttcggcgacaagcttgtccgggcacccctcgatccatcctcggatcgacttccctcaccg
tctgacttgattgagcgcatcctcatcaaggtcaaaaagtctcagccagtacctaacaca
ccatctgaggagtcgctgaagactgagcgacctggtcggcggcgcggcaacagcctaccc
tcaccttatcagaggccgtcacctttaccatctcccatggataacacatccgtcgctgtt
cctggaagtccctcgttgagtccaagtccgatgttgcgagcgacacggcaaattaacacc
atcacggaaggcgaggttcattcccacggggggcctagcaacagccccagcgaatacgag
agtgatgctgaaaaggattcggggaagaaggtggtgagcaaaatcaaccctatcctcggt
gaactgggcgtttattgcatgggcgttcactttgatgggttcgacagccccgacgctaaa
aagttcaaccatatcttttccttcaaagaaaagacctttgctgagagaagccagccgggt
gaagcaaagcgtgctttgtaccgtcataacatgcgctatctcatgcgtgtgtatccgaac
ggaggtcggatatcttctagcaactttgacccgctcctctattggaagcgcggggttcaa
atggcagcactgaactggcaaacattcgatctggggatgcagctgaatcaggctatgttt
gatagtggcaccgacctgtccggttatgttcttaaacccctcgagggacgtcagattcaa
gtcgtcccgacggatgctgccgggcagctatcgggtaaaagaccacggaagaggatctcg
ttcaagattgaggtcatctctgcgcagcagctgatgaggccattgaatcttcccaagggg
cggacgcttgatccctacgtcgaagtcgagattttcctggccgatgacaagaggaataag
caagatggtgccacaaatgcaccagctcaggagacgcagctgaaatatcgcaccgacatc
gtcaaagacaatggcttcaaccccgttttcaaaggcaataactcttatgagttcattgtt
accaccaagtaccctgatctcatctttgtgcgctggagcgtgaagcttggcgacaacaaa
ggatacaacgaccgcagcccccccttggcgactttcacagctaagcttggcggcctcaag
caaggctaccgcacgataccgctgcttgatcacaacgggtataactacctattctcgacc
ctcttctgcaaaatcaccaagagccagcctaccgatatcatggttacctactccagtgaa
gttccaaggaacagtgttagcaggatcaagaacatttttaatcagtccggcatcagcccc
aaatccagcatggatagtggccgggcctga

DBGET integrated database retrieval system