KEGG   Neurospora crassa: NCU01266Help
Entry
NCU01266          CDS       T01034                                 

Definition
similar to phosphoinositide-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ncr  Neurospora crassa
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    NCU01266
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    NCU01266
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     NCU01266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 769 aa AA seqDB search
MAFNEKAVHEFWQRQMRKKYADRVIPAEGETIELPDIERICRSLHMHLSPTEIRDNFNAA
KAAKATSNGVCDPTSPSSLNFNEFKEFVRLLKARSEISHVFKNHTTNPKAGMTRQEFIQF
LKEIQCEDVEEDSTHWNNIFSQFARRRRSKDAEQTISGDESLTISEAGFTGFLNSHFNSL
LIQEPSEYVLDRPMNEYYISSSHNTYLLGRQVRGISSVEGYISALERGCRCVEVDCWDGP
NDEPYVSHGHTWTTRIKFEEVIKTINKYAFVKSRFPLWISLEVRCNAATQANMAKIMIDI
FGDKLVRAPLDPSSDRLPSPSDLIERILIKVKKSQPVPNTPSEESLKTERPGRRRGNSLP
SPYQRPSPLPSPMDNTSVAVPGSPSLSPSPMLRATRQINTITEGEVHSHGGPSNSPSEYE
SDAEKDSGKKVVSKINPILGELGVYCMGVHFDGFDSPDAKKFNHIFSFKEKTFAERSQPG
EAKRALYRHNMRYLMRVYPNGGRISSSNFDPLLYWKRGVQMAALNWQTFDLGMQLNQAMF
DSGTDLSGYVLKPLEGRQIQVVPTDAAGQLSGKRPRKRISFKIEVISAQQLMRPLNLPKG
RTLDPYVEVEIFLADDKRNKQDGATNAPAQETQLKYRTDIVKDNGFNPVFKGNNSYEFIV
TTKYPDLIFVRWSVKLGDNKGYNDRSPPLATFTAKLGGLKQGYRTIPLLDHNGYNYLFST
LFCKITKSQPTDIMVTYSSEVPRNSVSRIKNIFNQSGISPKSSMDSGRA
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggccttcaacgaaaaggccgtccacgagttctggcaacgacaaatgagaaagaagtac
gcagatagggtcattccggctgaaggcgaaaccattgaacttcccgacattgagagaatc
tgtcgctctcttcacatgcacctatcgccgacagaaattcgcgacaactttaacgctgct
aaagctgccaaggctacctccaacggggtctgtgatcccacttccccttccagtttgaac
ttcaacgagtttaaagagttcgtgcggctattgaaggcgaggtctgagatcagccatgtc
ttcaagaatcatacgaccaaccctaaagcagggatgacgaggcaagaattcatacaattc
ttgaaggagattcaatgcgaagacgtggaggaagattctacgcattggaacaatatcttc
tctcagttcgcgcgtagacgcaggtccaaagatgccgagcagaccatcagcggggatgag
tcattgaccatatctgaggctggcttcactggatttctcaattcacatttcaacagtttg
ctcatccaggagccatccgaatatgttctcgaccgaccaatgaatgagtattatatctca
agctcacataatacatatcttcttggtcgccaagtccgtggaatctccagtgtcgaaggc
tatatttcggcacttgagcgtggttgcagatgcgttgaagtcgactgctgggacggcccg
aatgacgagccttatgtgtcacacggccatacctggaccacaaggatcaagtttgaagag
gtgatcaaaaccatcaacaagtatgcctttgtcaagtctcgctttcctctctggatatcg
ctggaggtccgctgtaacgctgcgactcaagccaacatggcaaagattatgattgacata
ttcggcgacaagcttgtccgggcacccctcgatccatcctcggatcgacttccctcaccg
tctgacttgattgagcgcatcctcatcaaggtcaaaaagtctcagccagtacctaacaca
ccatctgaggagtcgctgaagactgagcgacctggtcggcggcgcggcaacagcctaccc
tcaccttatcagaggccgtcacctttaccatctcccatggataacacatccgtcgctgtt
cctggaagtccctcgttgagtccaagtccgatgttgcgagcgacacggcaaattaacacc
atcacggaaggcgaggttcattcccacggggggcctagcaacagccccagcgaatacgag
agtgatgctgaaaaggattcggggaagaaggtggtgagcaaaatcaaccctatcctcggt
gaactgggcgtttattgcatgggcgttcactttgatgggttcgacagccccgacgctaaa
aagttcaaccatatcttttccttcaaagaaaagacctttgctgagagaagccagccgggt
gaagcaaagcgtgctttgtaccgtcataacatgcgctatctcatgcgtgtgtatccgaac
ggaggtcggatatcttctagcaactttgacccgctcctctattggaagcgcggggttcaa
atggcagcactgaactggcaaacattcgatctggggatgcagctgaatcaggctatgttt
gatagtggcaccgacctgtccggttatgttcttaaacccctcgagggacgtcagattcaa
gtcgtcccgacggatgctgccgggcagctatcgggtaaaagaccacggaagaggatctcg
ttcaagattgaggtcatctctgcgcagcagctgatgaggccattgaatcttcccaagggg
cggacgcttgatccctacgtcgaagtcgagattttcctggccgatgacaagaggaataag
caagatggtgccacaaatgcaccagctcaggagacgcagctgaaatatcgcaccgacatc
gtcaaagacaatggcttcaaccccgttttcaaaggcaataactcttatgagttcattgtt
accaccaagtaccctgatctcatctttgtgcgctggagcgtgaagcttggcgacaacaaa
ggatacaacgaccgcagcccccccttggcgactttcacagctaagcttggcggcctcaag
caaggctaccgcacgataccgctgcttgatcacaacgggtataactacctattctcgacc
ctcttctgcaaaatcaccaagagccagcctaccgatatcatggttacctactccagtgaa
gttccaaggaacagtgttagcaggatcaagaacatttttaatcagtccggcatcagcccc
aaatccagcatggatagtggccgggcctga

DBGET integrated database retrieval system