KEGG   Neurospora crassa: NCU01457Help
Entry
NCU01457          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
ncr  Neurospora crassa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 755 aa AA seqDB search
MNSDTRRIQSHHPHRAPGHPKNYYHAYPADRQLRDYVTSPTIIVSAILLFLSALYQLLIS
DRNTRTRLKNIIWARVVDIIPATLLFKVDGFLNPPLFSRPMTPAEIDDSHEAKSQALGRI
LGLDKPGGVMESVTSAGLKGLSTLSSVGWNFKNSTSDRPAGLGNNDNSCYQNSILQGLAS
LQGLPEYLARVSQLGSNAKSTMPTTQAMAGLIATLNDKANYGRSVWPPNVLKNMSTWQQQ
DAQEYFSKLLDQIDREVAKATATYKKSLAYDGDPPPDDGVSSHHSDDSGYHSSSQSSSVP
DIQLSRNPLEGLIAQRVVCVKCNHFEGLTMIPFNCLTLNLGSGQLGYDLYERLDYNARVE
FIEGVHCPRCSLLKMQQKIKGLIGMVATDEARVSEFRERLAAVEEALEEDMLDDKTLAEK
CKVPAKQRVESTKTKQTAISRPPKSLVIHINRSVFDERTGYMYKDSSAVRFPSILDLGPW
CLGSAKKRADLEGSNGVLPSSTSNGEQTAEDEEKWNVEPTASMVAGSQRPSALSGPLYEL
RAVVTHQGRHDSGHYVCYRKHYISPPEKENQPEAPPPQLVADDEVAAPKIQALDQKSISE
QDTTDEEDAPTPTSEDDEKTLMREDEEEATSQWWRLSDTDVFKVDEENVLERGDVFMLFY
ECVEPEMVRIPEREVTRTLSPQAEPGNHVHDRSESVTLAGSEKPEDVEMVKAEASEAGKD
MTTPTGTVAGQSPDTMVQVQHADSVAASGGMEQVD
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagataccagacgcatacaaagccaccacccacaccgggcccccggccatccc
aagaactattaccacgcctacccagctgatcgccaactccgggactacgtaaccagcccg
actattatcgtctccgccatcctcctcttcttatccgccctttatcaactattgatcagc
gatcggaacacccgtacacgcttaaagaacatcatctgggcgcgcgtggtcgatatcatt
ccggccactctactcttcaaagtcgacggcttcctcaacccgccactgttttccaggcct
atgacgcccgcagaaatagacgactcgcatgaagccaaaagccaagctctgggaaggata
ttgggtctggacaagccaggaggtgtcatggaatccgtgacttcggctgggctcaagggc
ctcagcaccttgtccagcgttggctggaacttcaaaaacagcacttcagatcgtccggca
ggattagggaacaacgacaactcatgctaccagaacagcattctccagggccttgcttcg
ctccagggcttgcccgagtacctggcccgggtatctcagctgggtagcaacgccaagtcg
acgatgccgaccacgcaagcaatggctgggctcatcgcaacactcaacgacaaagccaac
tatgggcgatctgtgtggccacccaatgtactcaagaacatgagcacgtggcagcagcaa
gacgcacaagagtacttttcaaagctgctggaccaaatcgacagggaggtggccaaggct
acagcaacctacaagaagtccttggcatatgacggcgatccaccgccggacgacggcgta
agcagccaccacagtgatgatagcggctaccatagctccagtcaaagttcatctgttccc
gacattcagctgtctaggaatccactcgaggggctcattgcccagagggtagtttgtgtt
aagtgcaatcacttcgaagggctgacaatgatcccgttcaattgtttgactctcaacctt
ggctctggacaacttggctatgacctttacgagaggctggactacaatgcccgggttgag
tttatcgaaggcgttcactgtcccaggtgctcactgctcaagatgcaacagaagatcaag
ggtctgatagggatggtcgcaaccgacgaagccagagtttcggagtttcgtgagaggtta
gccgcggtagaagaggcgcttgaagaagatatgcttgacgacaagacgctagctgagaag
tgcaaggttccggctaaacagcgagttgagtcgaccaagacaaagcagacggcaatttct
cggccacccaagagcttggtcattcacatcaaccggtccgtctttgacgagaggacaggc
tacatgtacaaggacagttccgctgtcaggtttcccagcatacttgatctaggaccttgg
tgcctcggaagcgcgaagaagcgggctgatctggaaggttcaaacggtgtccttccgagc
tcgaccagtaatggcgagcaaacggctgaagatgaggagaaatggaatgttgagccgacg
gcctccatggtggcgggctcccaacgcccatccgccctaagcgggccactctatgaatta
cgcgccgttgtcacgcaccagggacggcatgatagtggccactatgtctgctacaggaag
cattatatcagccctcctgagaaggaaaaccagcctgaggcaccgccgccacagcttgtt
gccgatgatgaggtggccgctccgaaaatccaggccctggaccagaagtcgataagcgag
caagataccacggatgaagaagacgccccaactcctacctcggaagatgacgagaagacg
ctcatgcgcgaggacgaagaggaagccacctcgcaatggtggcgacttagcgacaccgat
gtcttcaaggtagatgaggagaatgtgcttgaaagaggggacgtctttatgttgttctat
gagtgtgtcgaaccggaaatggtacggataccagaacgggaagtaacaaggaccctatct
cctcaagccgaacctggcaaccatgtccatgaccggtcagaatcggtcacgctggccggg
tcagagaaaccggaggatgtagagatggtcaaggccgaggcttcggaggccgggaaggat
atgaccacaccgaccgggacggtggcgggtcaatcgccggacacaatggtccaggtccag
catgcggactcggttgcggcatcggggggcatggagcaggttgattag

DBGET integrated database retrieval system