KEGG   Neurospora crassa: NCU01517Help
Entry
NCU01517          CDS       T01034                                 

Definition
glucoamylase I precursor
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ncr  Neurospora crassa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCU01517
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     NCU01517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 626 aa AA seqDB search
MHLVSSLLVVGAAFQAVLGLPDPLHEKRHSDIIKRSVDSYIQTETPIAQKNLLCNIGASG
CRASGAASGVVVASPSKSSPDYWYTWTRDAALVTKLIVDEFTNDYNTTLQNTIQAYAAAQ
AKLQGVSNPSGSLSNGAGLGEPKFMVDLQQFTGAWGRPQRDGPPLRAIALIGYGKWLVSN
GYADTAKSIIWPIVKNDLAYTAQYWNNTGFDLWEEVNSSSFFTIAASHRALVEGSAFAKS
VGSSCSACDAIAPQILCFQQSFWSNSGYIISNFVNYRSGKDINSVLTSIHNFDPAAGCDV
NTFQPCSDRALANHKVVVDSMRFWGVNSGRTAGKAAAVGRYAEDVYYNGNPWYLATLAAA
EQLYDAVYVWKKQGSITVTSTSLAFFKDLVPSVSTGTYSSSSSTYTAIINAVTTYADGFV
DIVAQYTPSDGSLAEQFDKDSGAPLSATHLTWSYASFLSAAARRAGIVPPSWGAASANSL
PGSCSASTVAGSYATATATSFPANLTPASTTVTPPTQTGCAADHEVLVTFNEKVTTSYGQ
TVKVVGSIAALGNWAPASGVTLSAKQYSSSNPLWSTTIALPQGTSFKYKYVVVNSDGSVK
WENDPDRSYAVGTDCASTATLDDTWR
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcgtctcttcgctcctcgtcgtgggcgccgccttccaggccgtgctcggtctg
ccggatcctctgcatgaaaagaggcacagcgacatcatcaagcggtctgtcgactcgtat
atccagaccgagactcccattgcgcagaagaaccttctgtgcaacatcggtgcttctgga
tgcagagcctccggtgctgcctctggtgttgtggttgcctccccttccaagtcgagccct
gactactggtatacctggactcgtgatgccgcccttgtcaccaagcttattgtcgacgaa
ttcaccaacgactacaacaccactcttcagaacaccattcaggcttatgctgctgcacag
gccaagcttcagggcgttagcaacccgtccggttccctctccaacggggccggtcttggt
gagcccaagttcatggtcgacctccagcagttcaccggtgcctggggccgcccccagagg
gatggccctccccttcgcgccattgccctcatcggctatggcaagtggctcgtcagcaac
ggttatgctgatacggccaagagcatcatctggcccattgtgaagaacgaccttgcctac
actgcccagtactggaacaacactggcttcgatctctgggaggaggttaacagctcttct
ttcttcaccatcgccgcctcccaccgtgctctcgttgagggttctgcttttgccaagtcc
gtcggcagctcttgcagcgcttgcgatgccattgccccccaaattctgtgcttccagcag
agcttctggtccaacagcggctacatcatctccaactttgtcaactaccgcagcggcaag
gacatcaactccgtcttgacttccatccacaacttcgaccccgctgccggttgcgatgtc
aacaccttccagccctgcagcgaccgggctcttgccaaccacaaggttgtcgttgactcc
atgcgcttctggggtgtcaactccggtcgcactgccggtaaggccgccgctgtcggtcgc
tacgctgaggatgtctactacaacggtaacccgtggtacctcgctactctcgccgccgcc
gagcagctctacgacgccgtctacgtctggaagaagcagggttctatcactgtcacctcc
acctccctcgccttcttcaaggacctcgttccctccgtcagcaccggcacctactccagc
tcttcctccacctacaccgccatcatcaacgccgtcaccacctatgccgacggcttcgtc
gacatcgttgcccagtacactccctccgacggctccctggccgagcagttcgacaaggat
tcgggcgcccccctcagcgccacccacctgacctggtcgtacgcctccttcctttccgcc
gccgcccgccgcgccggcatcgtccctccctcgtggggcgccgcgtccgccaactctctg
cccggttcctgctccgcctccaccgtcgccggttcatacgccaccgcgactgccacctcc
tttcccgccaacctcacgcccgccagcaccaccgtcacccctcccacgcagaccggctgc
gccgccgaccacgaggttttggtaactttcaacgaaaaggtcaccaccagctatggtcag
acggtcaaggtcgtcggcagcatcgctgcgctcggcaactgggcccccgccagcggcgtc
accctgtcggccaaacagtactcttccagcaacccgctctggtccaccactattgcgctg
ccccagggcacctcgttcaagtacaagtatgtcgtcgtcaactcggatgggtccgtcaag
tgggagaacgatcctgaccgcagctatgctgttgggacggactgcgcctctactgcgact
cttgatgatacgtggaggtaa

DBGET integrated database retrieval system