KEGG   Neurospora crassa: NCU01525Help
Entry
NCU01525          CDS       T01034                                 

Gene name
hda-1
Definition
(RefSeq) histone deacetylase-1
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     NCU01525 (hda-1)
Protein phosphatases and associated proteins [BR:ncr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NCU01525 (hda-1)
Messenger RNA biogenesis [BR:ncr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     NCU01525 (hda-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Linkage Group II; II
AA seq 744 aa AA seqDB search
MVDNDNDIVMDGQDTHPATIDVSATSNGITKTEPNGHDQSAPANDEKEEKLDDEKDPFIY
PARLKRRGLLPTGCCYDDRMKLHANADFGPNPHHPEDPSRIEHIMRIFKKEGLVFTGDDE
DLKKVIRTDPRRYMWRIPARHATKEEICIVHHPEHFRWVEDLSRKPTSELRRLSTIMDQG
RDSLYVGSMTFEAALISAGGAIETCKSVVVGNVKNAFAVIRPPGHHAEFDAPMGFCLFNN
VPIAAKICQTEYPEICRKILILDWDVHHGNGIQNMFYDDPNILYISLHVYMNGSFYPGKP
DNPMTPDGSIENCGAGPGLGKNVNIGWHDQGMGDGEYMAAFQKIVMPIAHEFDPDLVIIS
AGFDAADGDELGACFVSPACYAHMTHMLMSLANGKVAVCLEGGYNLAAISKSALAVARTL
MGEPPPKMDLPKINKEAARVLAKVQAYQAPYWECMRPGIVDVQEMQSQGGQRLHDVVRSA
QRFNLSEKFGMFPLYIQRDVLFKSFENQVLVTRNASEARKLLVVIHDPPELHAQPDPLDN
SLQPHDSWITDSIPQYIQWAINRKIGVIDINIPQYITHPEDTESLAPKVDERTQQAQIQE
LMCYIWDNYLQLYDNVDDIFLMGVGNAYLGVKLLLINRDVKSRISGVVNFVNGNLRPVKS
DVDTDLSSWYKDNSRVYVSADHACWADADLSRKVMKRRFGSVIRSNVSGLGRMMNEHFKD
VQDWMVDRMVPEEEKLGDEMVEDA
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacaacgacaatgatatcgtgatggacggccaagacactcatcctgccacaatt
gacgtgtcggcaacaagtaatggcatcaccaaaacagaaccgaatggtcatgatcagtcc
gcgccagccaacgacgagaaggaggaaaaactggacgacgagaaagatcccttcatctat
ccggctcgcctaaagcgaagaggtctccttccgacaggatgctgttacgacgatcgtatg
aaacttcacgcaaatgccgactttggtccaaatccccaccatcccgaagacccgtctcgt
atcgagcatatcatgaggatattcaagaaggaaggccttgtgttcactggcgacgatgag
gatctcaagaaggtcatccgcaccgacccgaggaggtacatgtggcgcattccggcccga
cacgcaaccaaggaggagatctgcatcgtccaccaccctgagcatttccgatgggtggaa
gatctgtcacggaaaccgacatcggagctccggcgcctctcgaccattatggatcaaggg
agagactccctgtacgtcggcagtatgacattcgaggcagcactgatctcagctggaggt
gctattgagacctgcaagagtgttgttgtcggtaatgtcaagaatgctttcgctgtgatc
cgtccgccaggccatcatgccgagttcgacgccccgatgggcttctgtctcttcaacaac
gtcccaatagcagccaagatctgccagaccgaataccccgagatttgccgcaagatactt
attttggactgggacgttcaccatggcaatggcatccagaacatgttctacgacgacccg
aatatcctgtatatctcgctacacgtctatatgaacggctcgttctaccctggaaaaccg
gataacccgatgacgccagatggcagtattgagaactgtggagcagggccaggcttggga
aagaacgtcaacattggctggcatgaccaaggaatgggtgacggcgagtacatggcagct
ttccaaaagattgtcatgccgattgcccacgagtttgatcccgacctcgtcattatctcc
gccggattcgacgctgcggacggcgacgagctgggtgcttgctttgtatcgccagcttgc
tacgctcacatgacacatatgctcatgtctttggccaacggtaaggtggcggtctgtcta
gaaggcggttacaaccttgcggccatttccaagtcagccttggccgtagcccgtacgctc
atgggcgaaccacccccaaagatggatctccccaaaatcaacaaagaggctgctcgagtt
ctggcaaaggtgcaggcgtaccaagcaccgtactgggaatgcatgcgaccaggcattgta
gatgtccaggagatgcagagtcaaggtggccaaaggttacatgatgttgtccgctcagct
cagcgcttcaacctttcggagaagtttggcatgttcccgctgtatatccagcgtgacgtg
ctgttcaagtcctttgagaatcaggtgttggttacacggaacgcaagtgaagcccgcaag
cttcttgtagttatccatgacccaccagaactgcatgcccagccagatccccttgacaac
agtctccagccacacgactcctggattacggacagcatcccgcagtacatccagtgggcc
atcaacaggaagattggcgttatcgatatcaacattcctcaatacattacacatccagag
gacacggagtcattggcccccaaggtcgacgagcgaacgcaacaagcacagatccaggag
ctcatgtgctacatatgggataactaccttcaactctacgacaatgtggacgacatcttc
ctcatgggtgtcggcaacgcttaccttggagtcaagctcctgctcattaacagagacgtg
aagtcgcgaatctcgggagtcgtcaattttgttaacggcaacctccgtcctgtgaaatcg
gacgtcgacacggatctttcatcgtggtacaaggataactctcgggtctatgtgtcggcg
gaccatgcatgttgggcggatgccgacttgagccggaaggttatgaagcgccggttcggt
tcggtcattcgcagcaacgtgagcgggttgggtcgcatgatgaatgagcactttaaggac
gttcaggattggatggtggataggatggtaccggaggaggagaaactgggggatgagatg
gtggaggacgcgtga

DBGET integrated database retrieval system