KEGG   Neurospora crassa: NCU01648Help
Entry
NCU01648          CDS       T01034                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ncr  Neurospora crassa
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    NCU01648
Enzymes [BR:ncr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     NCU01648
Glycosyltransferases [BR:ncr01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   NCU01648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 750 aa AA seqDB search
MATPTDGSERATTASGADPFGDAARRRNNPPVAPTATEKPQPEDKKKALVPVKKEQSFLD
CIASWEWIVAPVVFTFLAFFTRFWQIGLSPIVTWDEAHFGKFGSHYLKREFYFDVHPPAG
KLLVGLSGLLAGYNGSFEFKSGETYPEEINYTFMRQFNAFWGAVCVPLAYFTAKALHFKL
PAVWLVTLMVLCENSYTTISRFILLDSMLLFGTVATTLCWAKFHNLRKKSFTPEWAFWLF
LTGLSIGFVCSVKWVGLFVTALVGLYTIEDLWNKFGDTKMPVKVLAAHVAARVSCLIILP
FAVYLLSFAIHFWVLTNSGPGDAQMPSLFQANLRGTEVGRDSPLELAIGSRVTIKNMGYG
GGLLHSHVQTYPEGSNQQQVTCYHHKDANNDWFFYPNRREQAYDENSDEIRYIGDGSTVR
LIHAQTGRNLHSHEIPAPMTKSDKEVSCYGNLTVGDEKDHWKIEVVKDTNSRDRSKIRTL
TTAFRLKHEVLGCYLRAGTVNLPQWGFKQIETTCTKTNNPRDTYTHWNVESHTNPKLPPA
EPGQYKSQFLQDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHVGLRMCSWDDKT
VKYFLLGNPLVYWGSTAALGVFGLLVVWYTLRWQRGYKELGQDGIDQIHYAGVYPVIGWF
LHYLPFIVMGRVTYVHHYYPALYFAILCFGFLADWFLRAKSKLTQGIAYGILYATVIGLY
IFFMPISWGMVGPNQQYKYMKWFDNWRISD
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccccgacggatggctccgagcgagccaccacggcctccggtgccgatcccttt
ggagatgcggcccggagacgcaacaatcctccagtcgctcctactgctaccgaaaagccc
cagcccgaggataagaagaaggctctggttcccgtgaagaaggagcagagcttccttgat
tgtattgcgagctgggagtggatcgttgcccccgtcgtcttcacgttcctggctttcttt
acgcgtttctggcagattggtctttcccccatcgtgacatgggacgaagctcatttcgga
aaatttggtagccattacctcaagcgcgaattctactttgatgttcaccctcctgccgga
aagctcctcgttggtctgagcggattgcttgcgggttacaatggatctttcgagttcaag
tccggcgagacttatcccgaggaaatcaactacactttcatgcgccagttcaacgctttc
tggggcgccgtgtgcgttcccctggcctactttaccgccaaggcgcttcacttcaagctc
cctgccgtctggctcgtcactctcatggttctttgcgagaactcgtacaccaccatcagc
cgcttcatcctcctcgattctatgctcctcttcggtaccgtggccaccactttgtgctgg
gccaagttccataacctacgcaagaaaagcttcacgcctgagtgggccttctggttgttc
ctgactggtctcagcatcggctttgtctgcagtgtcaagtgggttggactcttcgttacc
gctctggtcggtctctacaccattgaggacctctggaacaagttcggcgataccaagatg
cccgtcaaggttcttgctgcccatgttgctgctcgcgtcagctgcctcattatcctgccc
tttgcggtttaccttttgagctttgccatccacttctgggttttgaccaactccggcccc
ggcgatgcccagatgccctcgctcttccaggctaacttgagaggcactgaggttggcagg
gacagccccttggagcttgctatcggctcccgcgtgactatcaagaacatgggctatggt
ggtggcctgcttcacagtcacgttcaaacctaccctgagggttccaaccaacaacaagta
acctgctatcaccacaaggatgccaacaacgactggttcttctaccctaaccgcagggag
caggcttatgacgagaactctgacgagattcgttacattggtgatggcagcaccgttcgc
ctcatccatgcccagaccggccgcaacctccactcccacgagatccccgctcccatgacc
aagagcgacaaggaggtttcttgctatggcaaccttaccgttggtgatgagaaggaccac
tggaagattgaggtcgtcaaggacaccaattctcgcgatcgctccaagatccgcactctc
accactgccttccgcttgaagcacgaggttttgggatgctacctccgcgctggaaccgtc
aatcttccccagtggggtttcaagcagatcgagactacctgcaccaagaccaacaaccct
cgtgacacctacactcactggaacgtcgagtcccatactaaccccaagctgcctcctgct
gaacccggtcagtacaagagtcaattccttcaggacttcattcacttgaacgttgccatg
atgacctcgaacaacgctcttgttcccgatcctgacaagcaggacgatttggcttcccaa
tggtggcagtggcctattcttcacgttggcttgagaatgtgcagctgggatgataagact
gtcaagtatttcctgcttggcaatcctctcgtctactggggctccactgccgctcttgga
gtatttggccttcttgttgtttggtacactctccgctggcagcgtggctacaaggagctc
ggccaggacggcatcgaccagatccactacgccggagtctaccctgtcatcggctggttc
ctccactacttgcccttcatcgtcatgggccgtgtcacctacgtccatcactattacccg
gcgctctacttcgccatcctctgcttcggtttccttgctgactggttcctcagagccaag
agcaagcttacccagggcattgcctatggtatcctttatgcgacagttattgggctttac
atcttcttcatgcccatcagctggggaatggtcggcccgaaccagcaatacaagtacatg
aagtggttcgataactggaggatctcggattag

DBGET integrated database retrieval system