KEGG   Neurospora crassa: NCU01808Help
Entry
NCU01808          CDS       T01034                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
ncr  Neurospora crassa
Pathway
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ncr00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 108 aa AA seqDB search
MGFSAGDSKKGANLFKTRCAQCHTLEEGGGNKIGPALHGLFGRKTGSVDGYAYTDANKQK
GITWDENTLFEYLENPKKYIPGTKMAFGGLKKDKDRNDIITFMKEATA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcttctctgccggtgattccaagaagggtgccaacctcttcaagacccgttgcgct
cagtgccacacccttgaggagggcggcggcaacaagatcggccccgctcttcacggcctc
ttcggccgcaagaccggctccgtcgacggctacgcctacaccgatgccaacaagcagaag
ggcatcacctgggacgagaacactctcttcgagtacctcgagaaccccaagaagtacatc
cctggtaccaagatggccttcggtggtctcaagaaggacaaggacaggaacgacatcatc
accttcatgaaggaggctactgcttaa

DBGET integrated database retrieval system