KEGG   Neurospora crassa: NCU01808Help
Entry
NCU01808          CDS       T01034                                 

Gene name
cyc-1
Definition
(RefSeq) cytochrome c-1
  KO
K08738  
cytochrome c
Organism
ncr  Neurospora crassa
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NCU01808 (cyc-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Linkage Group II; II
AA seq 108 aa AA seqDB search
MGFSAGDSKKGANLFKTRCAQCHTLEEGGGNKIGPALHGLFGRKTGSVDGYAYTDANKQK
GITWDENTLFEYLENPKKYIPGTKMAFGGLKKDKDRNDIITFMKEATA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcttctctgccggtgattccaagaagggtgccaacctcttcaagacccgttgcgct
cagtgccacacccttgaggagggcggcggcaacaagatcggccccgctcttcacggcctc
ttcggccgcaagaccggctccgtcgacggctacgcctacaccgatgccaacaagcagaag
ggcatcacctgggacgagaacactctcttcgagtacctcgagaaccccaagaagtacatc
cctggtaccaagatggccttcggtggtctcaagaaggacaaggacaggaacgacatcatc
accttcatgaaggaggctactgcttaa

DBGET integrated database retrieval system