KEGG   Neurospora crassa: NCU01919Help
Entry
NCU01919          CDS       T01034                                 

Definition
similar to ubiquitin C-terminal hydrolase
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
ncr  Neurospora crassa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 548 aa AA seqDB search
MSTINVVVKHQGKKYDVDVDTSATGEVFKYQLYSLTGVEPDRQKVLLKGSQLKDDTDMSK
VGLKPGQMIMMMGTPGEGGGAIVRPTEKVKFVEDMTEAEAAQQAGATPAGLQNFGNTCYL
NSTLQVLRSIPELNDALKSYKGEQSMLDPTSQLRNLYDMMSKTQEGIPPLAFLNALRVAF
PQFAERERDGHGYAQQDAEEAWSQILTQLKQKLKISEGDAARDASFIDKYMGLELTSVLE
CDEPGAKEAGEEPKTSKERLLKLNCHIDGQTNHLRDGIVNGLVEKLEKKSEVLDREATYT
KRSQISRLPKYLTVHFMRFFWKREVQKKAKIMRKVTFPHELDVVEFCTDELRKALIPVRD
KVREVRKEEHDIERARKRRKMNPIDGENAQGSQPSTSKDKKKDEKKPAGGDVEMTTEETF
KTDAEFEAEKEAEVLAAKKELYTLINQDLLKDEGANQSGLYELRGVITHQGASADSGHYT
AYVKKTGIKDPVTGKVGEEDGKWWWFNDDKVSEVEAEKITALAGGGESHSALILLYRAIP
LPSADGTQ
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaatcaacgtggtggtgaaacaccaaggaaagaaatacgacgtggatgtcgat
acctccgcgaccggcgaagtcttcaagtaccagctttacagcctgactggtgttgaaccc
gaccggcaaaaagtgctcctaaagggcagccaactcaaagatgataccgatatgagcaag
gtgggcctgaagcccggccagatgatcatgatgatgggaacgccaggtgagggtggaggc
gcaatcgtccgaccaaccgagaaggtcaagttcgtcgaggacatgacggaggccgaagca
gcacaacaagcgggagcgactccggccggtcttcaaaatttcggcaacacctgctacctc
aactcgacgcttcaagttctccgctccattcctgagcttaacgacgctctcaagtcctac
aagggtgaacaatcaatgctggaccctacgtcgcagctccggaatctttacgatatgatg
tcgaaaacacaggagggcattcctccgctcgcatttttgaatgctcttcgtgtcgccttc
ccccagtttgctgagagggaaagagacggccacggttatgcccagcaggatgcggaagaa
gcttggtcgcaaatcctaacccaactcaagcaaaagctcaagatttctgagggtgacgcc
gccagagacgcatccttcatcgacaagtacatgggactcgaacttaccagcgtcctcgag
tgtgacgaacccggcgccaaggaagccggagaggagccaaagacctcgaaggagcgtctt
ctcaagctcaactgccacatcgatggtcagaccaatcatctcagggatggaattgtcaac
ggtttggtggaaaagcttgagaagaagtcagaggttctggacagggaagcgacgtacact
aagcgttctcagatctcccggctacccaagtacctgaccgtgcacttcatgcgattcttc
tggaaacgtgaggttcagaagaaggccaagattatgcgcaaggtcacatttccccacgag
cttgatgtggtcgagttctgcacggatgagcttaggaaggctctcattcctgtcagggac
aaggtccgcgaggtgcgcaaggaggagcatgatattgaaagagcccgcaagcgcagaaag
atgaaccccattgacggcgaaaacgctcaaggatcccaaccttcgacatcaaaggacaag
aagaaggacgagaagaagcctgctggcggtgacgtggagatgaccacagaggagaccttc
aagacagacgccgagttcgaggccgagaaggaagctgaagtactggctgccaagaaggag
ctttacactttgattaaccaagatcttctcaaggacgaaggtgccaaccagtccggactg
tatgagcttcgcggtgtgatcacccatcagggcgccagcgccgacagcggtcattatacg
gcctacgtcaagaagacagggattaaggatcctgtcactggcaaggtcggtgaggaggac
ggcaagtggtggtggttcaatgatgacaaagtctctgaggtggaggcggaaaagatcact
gccctggctggcggtggagagtcacactcggccctgatcttgctctaccgcgcgattccc
cttcccagtgccgacggaacccagtag

DBGET integrated database retrieval system