KEGG   Neurospora crassa: NCU01932Help
Entry
NCU01932          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
ncr  Neurospora crassa
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ncr00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 1162 aa AA seqDB search
MSQISDADVSGKPDIVSVPSLESAIPLLENEQQNQARQQLQQEQQGAGQGITEPQPDAIV
VVPQPPADPSLPAQEPVPDTTGRFPRRARGNNAPVYNLARLTGTYVHGKRASKGDIVLQK
KRKPKGRKLQALLAQQALEAEQAAQLAAQGGTPANPAADVPSIQPATQETDKPDSNAPAD
TLTIPPVHAPAAPEPTFPESAASPDKNGAAEAADAPAEENRVDHESLDASVHEAPLELST
NTAELSSTTKADTAQDINLDPCGALIPALPVDVPDHIPAIAPSATRKPDTRGAKATEKDV
VKRPVGRPKKHTVTNIGKAARTALVETAEPATAEKVGTNTIGEAVTSSPKEAVPNVEKEA
ERGIEKEAEPSGTEDIQTGAWEDVPAETTGDVHTSTASQVKAVKAKGTKTTRGKATKAET
IKASAVVPATRRATRHSGVPVEDPILPLITPASGKKAKTAEPALSRVPRELKRLRDTNEF
VGIDTRPIRYSVWSNGKYVNVTEEKEPTAPAKKKAKVDSSTATVREDRKDKTVEPEAPTN
TDSSRPAVKQKRVKKWLNKGLYAGQQAPEDVTKSLTTQERKRLLNIPELAKSGPPNKVLP
LPIFNGLRLLIAGRDFKLPFDVCHPLPPGQPKPAAYRTMTKNRFIGQAAAIWKKTPHFED
FASKCVCTPEDGCAQDCQNRVMLYECDDTNCNVGKEFCQNRAFQMLTERTKKGGRYRIGV
EIIMEYTGEIITDEECERRMNEEYKNNECYYLMSFDQNMIIDATTGSIARFVNHSCSPNC
RMIKWIVSGQPRMALFAGDRPIQTGEELTYDYNFDPFSAKNVQKCLCGAPNCRGVLGPKP
KEVKPPKPPKAEVKGKKKVGKRKLQELLANGIENVVEGEGRSPKKLKVGNAQAGKATEDT
AKGAPTFVSRKVSKVSVSAKSKVASAKTTKTFTRKVSIATTRVVKSYSKKGAAAKSKTIT
LKAPSKGSSLTIVAADAAGSITAAETAGAEEEAGNKASKTARVTPKNTPRAKKMADAVQN
TPTIAEGDDGSIFDVPSSSSARKRAPSWKVRDSGVKNVSSLFRKARKSPVKIKDTADPAA
KSTAATTKIVKPRKAFTKGKVTRPGKAMPKLTVAKKTGKSVAKPAISKSGKGSVSTKGAT
KIRLVNKAADGQDENAAPELVV
NT seq 3489 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagatctctgatgcagatgttagtggcaaaccagatatcgtttccgtacccagt
ctagagagtgccatccctttgctagagaacgaacagcaaaaccaagctcgccaacagttg
caacaagaacaacaaggggctggccaggggataacagagccccaaccagacgccattgtt
gtggttccccaaccgcctgcggacccctcattgcccgctcaagagcctgtccccgacaca
acaggtcgatttccgcgccgtgcacgaggcaacaacgccccagtatacaacctcgcgaga
ttgaccggcacctatgtgcatggcaaacgcgcctcgaaaggtgacattgtcctccagaag
aagcggaaaccgaaaggtagaaaactacaggctctactggcccaacaggctctcgaagct
gagcaggccgctcaactggccgctcagggcggaactccagcaaaccctgccgcggacgta
ccatccattcaaccagcaacccaggaaaccgacaagcccgattcgaacgcgcccgccgac
acgctcaccatcccgcccgtccacgcgcccgcagcccccgagcccacatttcccgaatcc
gcagctagtcccgacaaaaatggcgccgctgaagcagccgacgccccagccgaggaaaat
cgcgtggatcatgagagtctcgacgcgtcggtgcatgaagcgccgcttgaactttccaca
aacacggccgaactgagctcgacgacaaaagccgataccgcacaagacataaacctcgac
ccctgcggcgcgctgattcccgccctgccagtcgatgttcccgaccatatccccgcgatc
gcaccgagcgcaaccagaaagcctgacacaaggggagccaaggcaaccgagaaggacgta
gtcaagaggcccgtcgggagacccaagaaacacacggtgacaaacataggcaaagcagcc
aggacagccctcgtcgaaacagccgagccggccactgccgaaaaagttgggacgaacact
atcggtgaagccgtaacaagctcccccaaggaagccgtacccaatgtcgagaaggaagct
gaacgcggcatcgaaaaagaagcggaaccaagcggcaccgaagatatacaaacaggtgca
tgggaagatgttccagcagaaacaactggggatgtacacacgagcacagccagccaagta
aaagcagtcaaagcgaagggtaccaaaacaacgagaggcaaggcaacgaaagctgaaacg
atcaaagcttcggctgtagtccctgctacgcgcagagcgacgcgtcattcgggcgtgccc
gttgaagaccctatcttgccattgatcacaccggcatcgggcaagaaagccaagacagct
gagcctgctctatctcgtgtcccacgcgaactaaaacgcttgcgagatactaacgaattc
gttggtatcgacacgcgtcctattcgatactctgtatggagcaacggaaagtatgtcaac
gtaactgaggagaaggagcccactgcaccagcaaagaagaaggccaaggtcgacagcagc
acagctacagtgcgcgaagataggaaggataagacggtggaaccagaggctccgacgaac
accgactcttctcgtccagctgtcaagcaaaagcgcgtcaagaagtggcttaacaagggt
ctctacgctggccagcaagcgcccgaggacgttaccaaaagcctcactacgcaggagagg
aagaggctcttgaatatcccagaactcgcgaagagtggcccaccgaacaaagtccttcca
ctgccaatcttcaatggattgcggctgctcatcgcaggtcgtgatttcaagctgccgttt
gatgtctgccacccattgcctcccggacagcccaagcccgccgcataccgcaccatgaca
aaaaaccgttttattggccaggccgcggcgatatggaagaagacccctcacttcgaggat
tttgcgtccaagtgtgtatgtacgcctgaagacggatgcgcacaagactgccagaatcgt
gttatgctgtacgagtgcgatgataccaactgcaacgtcggcaaggagttctgccagaac
cgggctttccagatgctcacggaaagaaccaagaaaggaggtcgttaccgcataggtgtt
gagatcattatggagtacacgggcgagatcatcaccgacgaggagtgtgaacgtcgaatg
aatgaggagtacaagaacaacgagtgttactatctcatgtcattcgaccaaaacatgatt
attgacgcaaccaccggtagtatcgcgcggttcgtcaatcattcatgctcccctaattgt
cgcatgatcaaatggatcgtctctgggcagccgagaatggcgctttttgcgggtgaccgc
cccattcaaaccggcgaggagctaacgtacgactacaactttgaccccttctccgctaag
aacgtgcagaagtgtttgtgcggtgcgcccaactgtcgaggtgtccttgggcccaaacct
aaggaagtgaagccgcccaagcctccgaaggcagaggtcaagggcaagaaaaaggttggt
aaaaggaagctccaagagctcctagccaacgggatagagaatgttgtagagggcgagggg
aggtcacccaagaaattgaaggtgggtaacgcccaagccggcaaagcgaccgaagataca
gcaaagggagctccaacattcgtgtcgcgaaaggtttccaaggtgtctgtcagcgccaag
tccaaggtcgcttcggcgaagaccaccaagacgttcactcggaaagtcagcattgcgacg
acgagagttgtcaaatcttattccaagaagggcgccgccgcgaagagcaagacgatcacg
ctgaaagctccgtcaaagggttccagcttgaccatagtcgcagctgatgcagccggctct
atcacagcggcagaaacggcgggggctgaagaggaggcaggaaacaaagcttccaagaca
gccagggtaactcccaagaatacgcccagggcaaagaagatggcggacgctgtccaaaac
actcctactattgcagagggagacgacggctcgatttttgatgtaccatcatcttcttct
gcaaggaaacgcgccccctcttggaaagtgcgggactcgggcgtaaaaaacgtatcatcc
ctcttcagaaaagccaggaaatcacctgtcaagatcaaggatactgccgatccggcggcc
aagtctacggcagccaccaccaagatcgtgaaaccgcgcaaggctttcacgaaggggaag
gtcacaagaccgggcaaggcgatgccaaagctgaccgttgctaagaagacgggcaagtcc
gtggctaagcctgcgatatcaaagtctggcaagggatctgtcagcactaagggtgcgacc
aagattcgcctcgttaataaggcggctgatggccaggatgaaaatgccgctccggaattg
gtcgtgtaa

DBGET integrated database retrieval system