KEGG   Neurospora crassa: NCU01932Help
Entry
NCU01932          CDS       T01034                                 

Gene name
set-3
Definition
(RefSeq) set-domain histone methyltransferase-3
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
ncr  Neurospora crassa
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    NCU01932 (set-3)
Enzymes [BR:ncr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     NCU01932 (set-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 1238 aa AA seqDB search
MAAIVAIAELARGLLSSDSSFVSAVSAPTDASIDASSNAPASLTSTPPTTVSPDNMSQIS
DADVSGKPDIVSVPSLESAIPLLENEQQNQARQQLQQEQQGAGQGITEPQPDAIVVVPQP
PADPSLPAQEPVPDTTGRFPRRARGNNAPVYNLARLTGTYVHGKRASKGDIVLQKKRKPK
GRKLQALLAQQALEAEQAAQLAAQGGTPANPAADVPSIQPATQETDKPDSNAPADTLTIP
PVHAPAAPEPTFPESAASPDKNGAAEAADAPAEENRVDHESLDASVHEAPLELSTNTAEL
SSTTKADTAQDINLDPCGALIPALPVDVPDHIPAIAPSATRKPDTRGAKATEKDVVKRPV
GRPKKHTVTNIGKAARTALVETAEPATAEKVGTNTIGEAVTSSPKEAVPNVEKEAERGIE
KEAEPSGTEDIQTGAWEDVPAETTGDVHTSTASQVKAVKAKGTKTTRGKATKAETIKASA
VVPATRRATRHSGVPVEDPILPLITPASGKKAKTAEPALSRVPRELKRLRDTNEFVGIDT
RPIRYSVWSNGKYVNVTEEKEPTAPAKKKAKVDSSTATVREDRKDKTVEPEAPTNTDSSR
PAVKQKRVKKWLNKGLYAGQQAPEDVTKSLTTQERKRLLNIPELAKSGPPNKVLPLPIFN
GLRLLIAGRDFKLPFDVCHPLPPGQPKPAAYRTMTKNRFIGQAAAIWKKTPHFEDFASKC
VCTPEDGCAQDCQNRVMLYECDDTNCNVGKEFCQNRAFQMLTERTKKGGRYRIGVEVFKT
EDRGYGVRSNRCFEPHQIIMEYTGEIITDEECERRMNEEYKNNECYYLMSFDQNMIIDAT
TGSIARFVNHSCSPNCRMIKWIVSGQPRMALFAGDRPIQTGEELTYDYNFDPFSAKNVQK
CLCGAPNCRGVLGPKPKEVKPPKPPKAEVKGKKKVGKRKLQELLANGIENVVEGEGRSPK
KLKVGNAQAGKATEDTAKGAPTFVSRKVSKVSVSAKSKVASAKTTKTFTRKVSIATTRVV
KSYSKKGAAAKSKTITLKAPSKGSSLTIVAADAAGSITAAETAGAEEEAGNKASKTARVT
PKNTPRAKKMADAVQNTPTIAEGDDGSIFDVPSSSSARKRAPSWKVRDSGVKNVSSLFRK
ARKSPVKIKDTADPAAKSTAATTKIVKPRKAFTKGKVTRPGKAMPKLTVAKKTGKSVAKP
AISKSGKGSVSTKGATKIRLVNKAADGQDENAAPELVV
NT seq 3717 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaattgtggcaatcgctgagctggctcgggggcttctcagttcagactcgagc
tttgtgagcgccgtgagcgcgcctaccgatgcgtccatcgatgcgtcttcaaatgcgccg
gcgtcgttgacctcgacaccgccaaccacggtctcgccggataacatgtcgcagatctct
gatgcagatgttagtggcaaaccagatatcgtttccgtacccagtctagagagtgccatc
cctttgctagagaacgaacagcaaaaccaagctcgccaacagttgcaacaagaacaacaa
ggggctggccaggggataacagagccccaaccagacgccattgttgtggttccccaaccg
cctgcggacccctcattgcccgctcaagagcctgtccccgacacaacaggtcgatttccg
cgccgtgcacgaggcaacaacgccccagtatacaacctcgcgagattgaccggcacctat
gtgcatggcaaacgcgcctcgaaaggtgacattgtcctccagaagaagcggaaaccgaaa
ggtagaaaactacaggctctactggcccaacaggctctcgaagctgagcaggccgctcaa
ctggccgctcagggcggaactccagcaaaccctgccgcggacgtaccatccattcaacca
gcaacccaggaaaccgacaagcccgattcgaacgcgcccgccgacacgctcaccatcccg
cccgtccacgcgcccgcagcccccgagcccacatttcccgaatccgcagctagtcccgac
aaaaatggcgccgctgaagcagccgacgccccagccgaggaaaatcgcgtggatcatgag
agtctcgacgcgtcggtgcatgaagcgccgcttgaactttccacaaacacggccgaactg
agctcgacgacaaaagccgataccgcacaagacataaacctcgacccctgcggcgcgctg
attcccgccctgccagtcgatgttcccgaccatatccccgcgatcgcaccgagcgcaacc
agaaagcctgacacaaggggagccaaggcaaccgagaaggacgtagtcaagaggcccgtc
gggagacccaagaaacacacggtgacaaacataggcaaagcagccaggacagccctcgtc
gaaacagccgagccggccactgccgaaaaagttgggacgaacactatcggtgaagccgta
acaagctcccccaaggaagccgtacccaatgtcgagaaggaagctgaacgcggcatcgaa
aaagaagcggaaccaagcggcaccgaagatatacaaacaggtgcatgggaagatgttcca
gcagaaacaactggggatgtacacacgagcacagccagccaagtaaaagcagtcaaagcg
aagggtaccaaaacaacgagaggcaaggcaacgaaagctgaaacgatcaaagcttcggct
gtagtccctgctacgcgcagagcgacgcgtcattcgggcgtgcccgttgaagaccctatc
ttgccattgatcacaccggcatcgggcaagaaagccaagacagctgagcctgctctatct
cgtgtcccacgcgaactaaaacgcttgcgagatactaacgaattcgttggtatcgacacg
cgtcctattcgatactctgtatggagcaacggaaagtatgtcaacgtaactgaggagaag
gagcccactgcaccagcaaagaagaaggccaaggtcgacagcagcacagctacagtgcgc
gaagataggaaggataagacggtggaaccagaggctccgacgaacaccgactcttctcgt
ccagctgtcaagcaaaagcgcgtcaagaagtggcttaacaagggtctctacgctggccag
caagcgcccgaggacgttaccaaaagcctcactacgcaggagaggaagaggctcttgaat
atcccagaactcgcgaagagtggcccaccgaacaaagtccttccactgccaatcttcaat
ggattgcggctgctcatcgcaggtcgtgatttcaagctgccgtttgatgtctgccaccca
ttgcctcccggacagcccaagcccgccgcataccgcaccatgacaaaaaaccgttttatt
ggccaggccgcggcgatatggaagaagacccctcacttcgaggattttgcgtccaagtgt
gtatgtacgcctgaagacggatgcgcacaagactgccagaatcgtgttatgctgtacgag
tgcgatgataccaactgcaacgtcggcaaggagttctgccagaaccgggctttccagatg
ctcacggaaagaaccaagaaaggaggtcgttaccgcataggtgttgaggtcttcaagacc
gaagacagaggatatggtgtgcgtagcaaccgctgctttgaaccccatcagatcattatg
gagtacacgggcgagatcatcaccgacgaggagtgtgaacgtcgaatgaatgaggagtac
aagaacaacgagtgttactatctcatgtcattcgaccaaaacatgattattgacgcaacc
accggtagtatcgcgcggttcgtcaatcattcatgctcccctaattgtcgcatgatcaaa
tggatcgtctctgggcagccgagaatggcgctttttgcgggtgaccgccccattcaaacc
ggcgaggagctaacgtacgactacaactttgaccccttctccgctaagaacgtgcagaag
tgtttgtgcggtgcgcccaactgtcgaggtgtccttgggcccaaacctaaggaagtgaag
ccgcccaagcctccgaaggcagaggtcaagggcaagaaaaaggttggtaaaaggaagctc
caagagctcctagccaacgggatagagaatgttgtagagggcgaggggaggtcacccaag
aaattgaaggtgggtaacgcccaagccggcaaagcgaccgaagatacagcaaagggagct
ccaacattcgtgtcgcgaaaggtttccaaggtgtctgtcagcgccaagtccaaggtcgct
tcggcgaagaccaccaagacgttcactcggaaagtcagcattgcgacgacgagagttgtc
aaatcttattccaagaagggcgccgccgcgaagagcaagacgatcacgctgaaagctccg
tcaaagggttccagcttgaccatagtcgcagctgatgcagccggctctatcacagcggca
gaaacggcgggggctgaagaggaggcaggaaacaaagcttccaagacagccagggtaact
cccaagaatacgcccagggcaaagaagatggcggacgctgtccaaaacactcctactatt
gcagagggagacgacggctcgatttttgatgtaccatcatcttcttctgcaaggaaacgc
gccccctcttggaaagtgcgggactcgggcgtaaaaaacgtatcatccctcttcagaaaa
gccaggaaatcacctgtcaagatcaaggatactgccgatccggcggccaagtctacggca
gccaccaccaagatcgtgaaaccgcgcaaggctttcacgaaggggaaggtcacaagaccg
ggcaaggcgatgccaaagctgaccgttgctaagaagacgggcaagtccgtggctaagcct
gcgatatcaaagtctggcaagggatctgtcagcactaagggtgcgaccaagattcgcctc
gttaataaggcggctgatggccaggatgaaaatgccgctccggaattggtcgtgtaa

DBGET integrated database retrieval system