KEGG   Neurospora crassa: NCU02076Help
Entry
NCU02076          CDS       T01034                                 

Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
ncr  Neurospora crassa
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:ncr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 248 aa AA seqDB search
MSEQVDLTTIPISPEGGNTNGDAAAAKDDKTVTVFHDKEHFNVKHPLSNRWTLWFTKPSS
GKGDNWNDLLKEVITFETVEEFWGVYNNIAPVSELALKSDYHLFKEGVRPEWEDPQNKHG
GKWSYQFKEKRNVNIDEIWLHTMLAAIGETLEDEEDGEVMGVVVNVRKAFFRVGVWTRTI
GKHIPGRGDGDISGGKGRSPEKGKEILMAIGRRFKEVLQLPPNEALEFSGHTESAHSGSS
RARAKMTV
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcaagtcgatctcaccaccatccctatcagccccgagggcggcaacaccaac
ggcgacgctgccgccgccaaggacgacaagaccgtcaccgtcttccacgacaaggagcac
ttcaatgtcaagcaccctctctccaaccgctggaccctttggttcaccaagccctcaagc
ggaaagggcgacaactggaatgatctcctgaaggaggttatcacctttgagacggtcgag
gagttctggggtgtatataacaacatcgccccggtatcagagcttgctctcaagtccgat
taccatctcttcaaggagggcgtgcgccccgagtgggaggatccccagaacaagcacggt
ggcaagtggtcttaccagttcaaggagaagcgcaatgtcaacattgacgagatctggctg
catactatgcttgctgcgatcggcgagactctcgaggatgaggaggacggtgaggtcatg
ggcgttgtcgtcaacgtccgcaaggccttcttccgtgttggtgtctggactcgcactatc
ggcaagcacattcccggccgcggcgacggagacatttctggcggcaagggtagatcccct
gagaagggcaaggagatcctgatggctatcggccgccgcttcaaggaggtcctccagctc
ccgcccaacgaggctctcgagttctccggccacacggaatccgctcacagcggcagctct
cgcgctcgtgccaagatgaccgtctaa

DBGET integrated database retrieval system