KEGG   Neurospora crassa: NCU02084Help
Entry
NCU02084          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ncr  Neurospora crassa
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ncr00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 374 aa AA seqDB search
MRSFVFFYLGIGGVAVHGIPHSFSSSSSSSFWVSSNNRGHPASLDDSTVDDIDIVTGSQF
HGLKTFASLPLSPDDQEPVMGRQELELEVNALEDSITTRVTAPRFQLTRCNGWLLADEDA
LHEWATIVDCGDATLTWLDNTVAFKHLDKAHRVISGRPTANDTVATVPRILTLGGDHSTT
LSALRSTFRRWGQVSVIHFDSHIDTWSPDVLGGISDYAGLNHGTFLHIAHEEGLIHNTSI
HAGTRGPIIMHSDRDNDKRCGFAVITARDIDKHGIDWIISTIKARVGNSRVYISVDIDVL
DPAFAPGTGTAEPGGWSTRELLTIIDGLRGLSVVGADVVEVSPVYDNTGETTVLAAAQVG
LSLISLMVARPVSD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagatcatttgtgttcttctacctcggcatcggcggggtagcagtgcacggtatccct
cattccttctcctcctcctcctcctcgtccttctgggtctccagcaacaacagaggacat
ccagcttcgcttgatgattcaactgtagacgacatcgatatcgtgacgggaagtcagttt
cacggactcaagacattcgccagtcttccgctgtcaccggacgaccaggagcccgttatg
ggccgacaggaattagaactggaagtcaacgccttggaggattcgattactacacgggtc
accgctcccagattccaactaactcgatgtaatggttggttacttgcagacgaagatgca
ttgcatgaatgggctaccatcgtggactgcggcgacgcaaccttgacctggctcgacaac
accgttgccttcaagcatctcgacaaggcgcatcgagtcatatccggacggcccaccgcc
aacgacacggttgcaacggtgccgagaatattgacgttgggtggtgatcacagtaccact
ctttcggcactgcgatcaacgtttcgacgatggggtcaggtgtccgtgatacatttcgat
agtcacatcgacacatggagtcccgacgttctcggaggcatctctgactatgcaggtctc
aaccacggaaccttcctccacatcgcccacgaagaaggcttaatccacaacacctccatc
cacgccggcacgcgcggccccatcatcatgcacagtgaccgtgataacgacaagcgctgc
ggcttcgccgtcatcacagcccgggacattgacaagcacggtatcgactggatcatctcc
accatcaaggcccgagtgggtaactcgagggtgtacatcagcgtcgacattgacgttttg
gatccggcgtttgctccgggcacgggcaccgccgagccaggtggctggtcaacgagggaa
ctgctgactatcattgacgggctgagaggcttgtctgtcgtcggggccgatgtggttgag
gtgagtccggtttatgacaatacgggggagacgacggttctggcggctgcgcaggttggg
ctgtcgctcatcagtttgatggtggcgaggccggtgagtgactga

DBGET integrated database retrieval system