KEGG   Neurospora crassa: NCU02208Help
Entry
NCU02208          CDS       T01034                                 

Definition
eukaryotic translation initiation factor 3
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
ncr  Neurospora crassa
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NCU02208
Messenger RNA biogenesis [BR:ncr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     NCU02208
Translation factors [BR:ncr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    NCU02208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 747 aa AA seqDB search
MAPSFDHLRDEDLDEDDFDVDEVDISDIREKYEVQLEQGYDAFVVVDGLPEVNEEQKPKL
VKFLLKKLNTVGKTREDLIFMPMGEDGKSLRFAFVEYSSPAEAAAACRQLDLVPLDKKHT
LRVNKLTDVDRYGREGRIDDEYTPPKIEEFQEKEHLRSFMADPSGRGRDQFVMFRGESVG
VFWNNEKDTPENIVDRQHWTETFVQWSPLGTYLTSVHAQGVQLWGGPSWTRQRRFAHPFV
NLVAFSPNEKYLVTWSNRPISIPEEGHPALSVEDDGKNYVIWDIETSKPLRSFAQLDTPA
AAEGEAPKKAPKFPWPAFKWSADDKYVARLNPGQSISVYELPRMNLLDKTAIKIEGVVDF
DWAPATVQRDGVKSYEQLFCFWTPEIGSNPARVGLMSIPSKQVVRSLNLFSVSDAKLHWQ
SEGAYLCVKVDRHSKSKKSQATTLEIFRVKEKGVPVEVVDTIKDTVINFAWEPKGDRFVI
ITTTEPVGATAVPPKTSVAFFCPEKAKGNAVGNFKHLRTLEKKNSNAIYWSPKGRFVVVA
TVANTQSSDLDFYDLDFEGEKPESDKDLTANLQLMNTADHYGVTDVEWDPSGRFVATWAS
AWKHSMENGYHLYDFKGEQLREEAIEKFKQFQWRPRPATLLSKEEQKAIRRNLREYSRIF
EQEDAERISSADVAVVEARRRLLEEWFAWREAIRQEVAEEREIYGLPADPVADLIKAKTP
ELATDQEEQVIEEIMEEVLEETEEIVQ
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctctttcgaccacctccgcgacgaggacctcgacgaggatgacttcgatgtt
gatgaggtcgacatttccgatatccgcgagaagtacgaggttcagcttgagcagggctac
gatgcctttgtcgttgtcgacggcctccccgaggtcaacgaggagcaaaaacccaagctc
gtcaagttcctgttgaagaagctcaacacggttggcaagacccgggaggacctcatcttc
atgcccatgggcgaggatggaaagtcgctgaggttcgcctttgtcgagtactcgtcgccc
gccgaggccgctgccgcctgcagacagctcgacctcgtccccctcgacaagaagcacacc
ctccgcgtcaacaagcttaccgatgtcgaccgctatggtcgcgagggccgtatcgatgac
gagtacactcctcccaagatcgaggagttccaggagaaggagcacctccgctccttcatg
gccgaccccagcggccgcggcagagatcagtttgtcatgttcaggggagagtccgttggt
gtcttctggaacaacgagaaggatacgcccgagaatattgttgaccgccaacactggacc
gagacctttgtgcagtggtcgcccctcggtacctaccttacctccgtccacgcccagggt
gttcagctttggggtggtccctcgtggaccaggcaaaggcgttttgcccatccttttgtc
aaccttgtcgccttctctcccaacgaaaagtaccttgtcacctggtccaacaggccgatt
tcgattcctgaggagggtcaccccgctctttctgtagaagacgacggcaagaactacgtt
atctgggatatcgagacctccaagccccttcgttctttcgcccagctcgacacccccgcc
gccgccgagggcgaggctcccaagaaggcccccaagttcccctggcccgccttcaagtgg
tctgccgatgacaagtacgtcgccaggctgaaccccggccagtctatttccgtctacgag
cttccgaggatgaacttgttggacaagaccgccatcaagatcgagggcgttgtggacttt
gactgggctcccgccaccgtgcagcgcgacggtgtcaagtcctacgagcaacttttctgc
ttctggacccctgagattggcagcaaccccgccagagtcggcttgatgagcatcccctcc
aagcaagttgtcaggtcactgaacctcttcagcgtctcggatgccaagctccactggcag
tccgagggtgcttatctgtgcgtcaaggttgaccgtcactccaagtccaaaaagtctcag
gctaccactcttgagattttccgtgtcaaggagaagggagtccctgtggaagttgtcgac
accatcaaggataccgtaataaactttgcctgggagcccaagggcgacaggttcgttatc
atcaccaccaccgagcctgtcggtgccaccgcggttccccccaagacgtcggtcgctttc
ttctgccctgagaaggccaagggcaatgctgttggaaacttcaagcacctccgcactctc
gagaagaagaacagcaatgccatctactggtcgcctaagggacgctttgtggtcgttgcc
actgttgccaacactcagagctctgatctcgacttttacgacctcgactttgagggcgag
aagcccgagtccgacaaggaccttaccgccaaccttcagcttatgaacaccgctgaccac
tacggtgtcaccgacgttgagtgggacccctcgggtcgcttcgttgccacctgggcttcc
gcgtggaagcactctatggagaacggatatcatctgtatgacttcaagggtgagcagctg
cgcgaggaggctatcgagaagttcaagcagttccagtggaggccgcgccccgctaccctc
cttagcaaggaggagcagaaggccatccgccgcaacctccgcgagtactcgaggatcttc
gagcaggaagacgccgagcgcatcagcagcgccgacgttgccgttgtcgaggcccgccgc
cgcctcctcgaggagtggttcgcttggcgcgaggccatcaggcaggaggttgccgaggag
cgcgagatctacggccttccggcggatcccgttgccgacctcatcaaggccaagaccccc
gagctcgccaccgaccaggaggagcaggtcatcgaggagatcatggaggaggtgttggag
gagaccgaggagatcgttcagtaa

DBGET integrated database retrieval system