KEGG   Neurospora crassa: NCU02281Help
Entry
NCU02281          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NCU02281
Peptidases [BR:ncr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NCU02281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 1080 aa AA seqDB search
MASTTTVEPSSRPSYITHVCSLCRQTVSVDVLRPHLKTAWINRIMDKDRIRNALAIAKRE
EPERYGDLTPEKEENYANSPLQTLNMYIKNILEDDWSAPQKRIASRNRTFSVQFGPACAD
IFLYLGFTEEVDVSTGDKFWVPPRLPISAFRTPLGSQRAFLENVRSEVQSFLAENPPRPD
LPVVGATVNAIERLDRVLISDWLRSHETRSARSSDEAQHFRILGASERSDEEVLKYAFLQ
QVDVDPANRDTYKTALANLAGYRSEEFQMYVFSLDESPAAPSGPQSQEPPSDVDKAYRHF
NIEPKTNADARYFINVYKTYREQSPGQLSSHRIALLKIGKDRDDSEILDEVFNGVMDHNE
ACSILDSEPGWSLEIAAAGAREAVKNGIDRRLVIKACETLADAMRKENGADENGWAEFDM
VLAELRAPDFLLPNAEQGPQFEDTTEFMSLPVGLDNLRNTCYLNSILQYFYSVTAVRNFV
LSADQTPLEPTQEAMRALLDGLDPSELDPGRAYVGSEFCRELGSLFRDIQGAGTRSVRPR
QRLANAALLRPDRIRSGPLDGPVDNASKPATVEAPPLPPRSGAGDLPKVTVDAVPEHSET
DSNLSSQTLVNQTEDDPTFIVVDCNAGKGESTGDDITMTDEPAPSTPVADSANTGNDRPR
DLKLTVAELDEELGKPNVGSDQMDVDEVMGNAIDHLRAAFRVESLRNPITSGPDPIKEAF
FSTLVDNRKKTSESTWNSSTRSERWVIAYPGKNERISLYDALSRSFDLESVGAELLTYTT
IKDPAPNFHICISRSDGRNKNANPVIIPELLYLDRFMHTEQLDSPLFKARQRSWNIGNRL
QELMSCDNKMKETESAMPIPFVVQNERSSDSLLESYIHISDQDVEELRGHNVTSFLTPEL
DATVEKYTSLPRPESFQPDIKPEAPNLDQEELRDLSPSEIETFVTSIEAEAAWEKGQLLA
EREKLFDGMHQYVYRLHAVVCHAGTTAAAGHYWVWIYDFEENVWRKYNDTTVSVHPAEEV
FEQLNTRGEPYYVAYVRAENVKDLVSIPRRRFAGLPVGSDEPTTVWAETVDKMDLDAQNA
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgaccacgacggtcgagcccagctcgcgcccctcgtacatcactcacgtctgc
tcgctctgcaggcagaccgtttctgtcgacgttttgcggccacacttgaaaacagcctgg
atcaaccggatcatggacaaggacaggataagaaacgctttggcgatcgccaagagggaa
gagccagaacgctacggcgatctaacaccagaaaaggaggagaactatgccaattcgcct
ttacagaccctcaacatgtacatcaaaaacattctcgaggacgactggagcgccccgcag
aagcgcatcgccagccgcaacaggaccttctcagtccagtttggcccagcatgtgccgac
atattcctttatcttggcttcacggaagaagtggatgtctcaaccggagacaagttctgg
gtaccccctcggcttcctatttcagcctttcgaacacccctgggctcacaacgtgctttt
ctcgagaacgtcagaagcgaggtgcaaagttttctagccgagaaccctccgaggccggac
ctacccgtcgtgggggcaacggttaatgcgatagagcggctggacagggtcctgatatcg
gactggcttcgcagccacgagacccgatcggcgcgaagctcggatgaggcccagcacttt
cgcatcttgggagcatccgaaaggtcggatgaggaggtgctcaagtatgccttcctccaa
caagtggacgtggatccggcgaacagagacacctacaagactgcgcttgccaatctggct
ggctacaggagtgaagagtttcagatgtacgtcttcagtttggacgagagtcctgccgcc
cccagcggtcctcaatctcaggagcctccttcagacgtagacaaagcgtataggcacttt
aatattgagccgaaaacgaacgcagacgctcggtattttatcaacgtttacaaaacctac
agagagcagtcaccaggacagctatctagtcacagaattgcccttctcaaaattggcaag
gacagggatgactcggagatacttgacgaggtgtttaacggagtgatggaccacaacgag
gcatgctcaattctggattccgagcctggctggtccttggagattgctgctgcgggtgca
cgggaggccgttaagaacggcattgatcgcagactggtcatcaaagcctgtgaaacgctc
gcggatgccatgaggaaggagaacggggcggacgaaaacggctgggcagaattcgatatg
gttctcgcagaactccgggctccggatttcctcctacccaatgcggaacaaggcccccag
tttgaagatacgaccgagtttatgtcactacccgttggcctcgacaacctccgaaacaca
tgctatctcaacagcatccttcagtatttctactcagtcacggccgtgaggaactttgta
ttgtcagcggaccagacacctttggagccaacccaggaagctatgcgggctcttctagat
ggcctagatccatctgaacttgaccctggccgggcttatgtcggatccgaattttgtcgt
gaactgggctccctgtttcgtgacattcagggcgccggcacccgctccgtgaggcccaga
cagcgtctggccaatgcagctttgctcaggccagacagaatacgcagtgggcctttagat
ggacctgttgacaatgcgtccaagccggccacggtcgaggctcctccattgcctcccaga
tcaggcgcgggcgacttacctaaggttacggttgacgcagtaccagagcattcggagacg
gacagcaacctgagctcccagaccttggtcaaccagactgaagacgacccgacattcatc
gttgtcgactgcaatgccggtaaaggtgaaagcacaggcgacgatatcaccatgactgat
gaacctgctccgtctacccctgtcgccgattccgccaatactggaaacgacaggcccaga
gacctgaaactgacggttgcagaacttgatgaagagcttggtaagcccaacgttggttct
gaccagatggatgtcgacgaagtcatgggcaacgcaatagaccatcttcgggcagctttc
agggtcgaatcgcttagaaatccgattacgtcagggccagacccgatcaaggaagccttc
ttctcgacgctggtcgacaaccggaaaaagactagtgaaagtacttggaacagctccaca
agatctgaacgttgggtgattgcctaccccggaaagaatgagcggatatcgttgtacgat
gctttgtccagatcattcgatctggaaagcgtgggtgcagagcttctaacctatacaacc
atcaaggacccggctcccaacttccacatctgcatttcgaggtcagatggccgcaacaaa
aacgccaaccctgtcatcattcccgagctcttatacctcgatcgctttatgcacacggaa
cagctcgactcgccgctattcaaagcccgtcaaagaagctggaatattggaaaccggctc
caagagctcatgtcttgtgacaacaagatgaaagagactgagtctgccatgccaattccc
ttcgtagtgcagaatgagagaagctcagacagccttctagagtcctacattcacataagt
gatcaggacgttgaggagctcagaggacacaatgtcacatcattcttgacgcccgagctg
gacgccactgtcgagaaatatactagcctgcccaggcctgagtcattccagccagacatc
aaacctgaggcgccgaatcttgatcaagaagagcttcgcgatctcagtccaagtgaaatc
gagactttcgtcacgagcattgaggctgaagcggcttgggaaaaggggcagctgttggcc
gagcgtgagaagctgtttgatggcatgcatcagtatgtataccggcttcacgcagtcgtc
tgccatgccggaaccacggccgccgccggtcactactgggtctggatttacgactttgag
gagaacgtttggcgcaagtacaatgacaccacggtgtctgtccacccggctgaggaagta
tttgagcagctgaacaccaggggtgagccatactacgtggcctacgtacgggcagaaaac
gtcaaggacctcgtaagcatcccacgccgtcggttcgcgggacttccggttggctctgac
gaacccacgacggtgtgggctgagacggtggataagatggacttggatgctcagaatgct
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system