KEGG   Neurospora crassa: NCU02281Help
Entry
NCU02281          CDS       T01034                                 

Definition
(RefSeq) hypothetical protein
  KO
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NCU02281
Peptidases [BR:ncr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NCU02281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Linkage Group VII; VII
AA seq 1202 aa AA seqDB search
MDLAPTPPLPPKAGRLASRWLQDLLQGVLREGDPVFDCYSLRDPSRRDTSSCRLHELVII
GSQSHGIDHDGRAQLAPLVVSCMCKLCRHHFVVRYTIPEDECGQLHTAQAHHYVVDAMVD
RPTSPLEASKLYPRVTSITHVCSLCRQTVSVDVLRPHLKTAWINRIMDKDRIRNALAIAK
REEPERYGDLTPEKEENYANSPLQTLNMYIKNILEDDWSAPQKRIASRNRTFSVQFGPAC
ADIFLYLGFTEEVDVSTGDKFWVPPRLPISAFRTPLGSQRAFLENVRSEVQSFLAENPPR
PDLPVVGATVNAIERLDRVLISDWLRSHETRSARSSDEAQHFRILGASERSDEEVLKYAF
LQQVDVDPANRDTYKTALANLAGYRSEEFQMYVFSLDESPAAPSGPQSQEPPSDVDKAYR
HFNIEPKTNADARYFINVYKTYREQSPGQLSSHRIALLKIGKDRDDSEILDEVFNGVMDH
NEACSILDSEPGWSLEIAAAGAREAVKNGIDRRLVIKACETLADAMRKENGADENGWAEF
DMVLAELRAPDFLLPNAEQGPQFEDTTEFMSLPVGLDNLRNTCYLNSILQYFYSVTAVRN
FVLSADQTPLEPTQEAMRALLDGLDPSELDPGRAYVGSEFCRELGSLFRDIQGAGTRSVR
PRQRLANAALLRPDRIRSGPLDGPVDNASKPATVEAPPLPPRSGAGDLPKVTVDAVPEHS
ETDSNLSSQTLVNQTEDDPTFIVVDCNAGKGESTGDDITMTDEPAPSTPVADSANTGNDR
PRDLKLTVAELDEELGKPNVGSDQMDVDEVMGNAIDHLRAAFRVESLRNPITSGPDPIKE
AFFSTLVDNRKKTSESTWNSSTRSERWVIAYPGKNERISLYDALSRSFDLESVGAELLTY
TTIKDPAPNFHICISRSDGRNKNANPVIIPELLYLDRFMHTEQLDSPLFKARQRSWNIGN
RLQELMSCDNKMKETESAMPIPFVVQNERSSDSLLESYIHISDQDVEELRGHNVTSFLTP
ELDATVEKYTSLPRPESFQPDIKPEAPNLDQEELRDLSPSEIETFVTSIEAEAAWEKGQL
LAEREKLFDGMHQYVYRLHAVVCHAGTTAAAGHYWVWIYDFEENVWRKYNDTTVSVHPAE
EVFEQLNTRGEPYYVAYVRAENVKDLVSIPRRRFAGLPVGSDEPTTVWAETVDKMDLDAQ
NA
NT seq 3609 nt NT seq  +upstreamnt  +downstreamnt
atggacttggcccctaccccgccacttccccccaaagcaggtcgtctggcttcacgctgg
cttcaagacttgctgcagggcgtcctgcgtgagggcgatcctgtcttcgactgctattct
ttgcgagacccttcacgccgtgacacttcgtcatgccggctccatgaactggtcattatt
ggctcgcaaagccatggcatcgaccacgacggtcgagcccagctcgcgcccctcgtagta
agctgcatgtgcaagctttgccgtcaccacttcgttgtcagatacaccattcccgaagac
gaatgcggccaactccataccgcacaagctcaccactatgttgttgatgccatggtagac
aggccgacctccccacttgaggcttcaaaattatatccccgtgtcaccagcatcactcac
gtctgctcgctctgcaggcagaccgtttctgtcgacgttttgcggccacacttgaaaaca
gcctggatcaaccggatcatggacaaggacaggataagaaacgctttggcgatcgccaag
agggaagagccagaacgctacggcgatctaacaccagaaaaggaggagaactatgccaat
tcgcctttacagaccctcaacatgtacatcaaaaacattctcgaggacgactggagcgcc
ccgcagaagcgcatcgccagccgcaacaggaccttctcagtccagtttggcccagcatgt
gccgacatattcctttatcttggcttcacggaagaagtggatgtctcaaccggagacaag
ttctgggtaccccctcggcttcctatttcagcctttcgaacacccctgggctcacaacgt
gcttttctcgagaacgtcagaagcgaggtgcaaagttttctagccgagaaccctccgagg
ccggacctacccgtcgtgggggcaacggttaatgcgatagagcggctggacagggtcctg
atatcggactggcttcgcagccacgagacccgatcggcgcgaagctcggatgaggcccag
cactttcgcatcttgggagcatccgaaaggtcggatgaggaggtgctcaagtatgccttc
ctccaacaagtggacgtggatccggcgaacagagacacctacaagactgcgcttgccaat
ctggctggctacaggagtgaagagtttcagatgtacgtcttcagtttggacgagagtcct
gccgcccccagcggtcctcaatctcaggagcctccttcagacgtagacaaagcgtatagg
cactttaatattgagccgaaaacgaacgcagacgctcggtattttatcaacgtttacaaa
acctacagagagcagtcaccaggacagctatctagtcacagaattgcccttctcaaaatt
ggcaaggacagggatgactcggagatacttgacgaggtgtttaacggagtgatggaccac
aacgaggcatgctcaattctggattccgagcctggctggtccttggagattgctgctgcg
ggtgcacgggaggccgttaagaacggcattgatcgcagactggtcatcaaagcctgtgaa
acgctcgcggatgccatgaggaaggagaacggggcggacgaaaacggctgggcagaattc
gatatggttctcgcagaactccgggctccggatttcctcctacccaatgcggaacaaggc
ccccagtttgaagatacgaccgagtttatgtcactacccgttggcctcgacaacctccga
aacacatgctatctcaacagcatccttcagtatttctactcagtcacggccgtgaggaac
tttgtattgtcagcggaccagacacctttggagccaacccaggaagctatgcgggctctt
ctagatggcctagatccatctgaacttgaccctggccgggcttatgtcggatccgaattt
tgtcgtgaactgggctccctgtttcgtgacattcagggcgccggcacccgctccgtgagg
cccagacagcgtctggccaatgcagctttgctcaggccagacagaatacgcagtgggcct
ttagatggacctgttgacaatgcgtccaagccggccacggtcgaggctcctccattgcct
cccagatcaggcgcgggcgacttacctaaggttacggttgacgcagtaccagagcattcg
gagacggacagcaacctgagctcccagaccttggtcaaccagactgaagacgacccgaca
ttcatcgttgtcgactgcaatgccggtaaaggtgaaagcacaggcgacgatatcaccatg
actgatgaacctgctccgtctacccctgtcgccgattccgccaatactggaaacgacagg
cccagagacctgaaactgacggttgcagaacttgatgaagagcttggtaagcccaacgtt
ggttctgaccagatggatgtcgacgaagtcatgggcaacgcaatagaccatcttcgggca
gctttcagggtcgaatcgcttagaaatccgattacgtcagggccagacccgatcaaggaa
gccttcttctcgacgctggtcgacaaccggaaaaagactagtgaaagtacttggaacagc
tccacaagatctgaacgttgggtgattgcctaccccggaaagaatgagcggatatcgttg
tacgatgctttgtccagatcattcgatctggaaagcgtgggtgcagagcttctaacctat
acaaccatcaaggacccggctcccaacttccacatctgcatttcgaggtcagatggccgc
aacaaaaacgccaaccctgtcatcattcccgagctcttatacctcgatcgctttatgcac
acggaacagctcgactcgccgctattcaaagcccgtcaaagaagctggaatattggaaac
cggctccaagagctcatgtcttgtgacaacaagatgaaagagactgagtctgccatgcca
attcccttcgtagtgcagaatgagagaagctcagacagccttctagagtcctacattcac
ataagtgatcaggacgttgaggagctcagaggacacaatgtcacatcattcttgacgccc
gagctggacgccactgtcgagaaatatactagcctgcccaggcctgagtcattccagcca
gacatcaaacctgaggcgccgaatcttgatcaagaagagcttcgcgatctcagtccaagt
gaaatcgagactttcgtcacgagcattgaggctgaagcggcttgggaaaaggggcagctg
ttggccgagcgtgagaagctgtttgatggcatgcatcagtatgtataccggcttcacgca
gtcgtctgccatgccggaaccacggccgccgccggtcactactgggtctggatttacgac
tttgaggagaacgtttggcgcaagtacaatgacaccacggtgtctgtccacccggctgag
gaagtatttgagcagctgaacaccaggggtgagccatactacgtggcctacgtacgggca
gaaaacgtcaaggacctcgtaagcatcccacgccgtcggttcgcgggacttccggttggc
tctgacgaacccacgacggtgtgggctgagacggtggataagatggacttggatgctcag
aatgcttag

DBGET integrated database retrieval system