KEGG   Neurospora crassa: NCU02375Help
Entry
NCU02375          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ncr  Neurospora crassa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 522 aa AA seqDB search
MSANAASSKDHKVKEPQPGQPMYGCEHVGRLFNQDQATINMSIQHYKTILRAIFDINPIL
SHTAKGVDGQVVTSITPTYLCLQCPSTLTDDDLTKHGNKKSHRFYVESRSGAVYCQMCDD
IVWDPTFEDLRLKKLGTGSFFGSRKRKHEELFAPDPVKDAPQYISTNTTLATCKANGLRG
IYNAGATCYQNVVLQSFLHNPILRNFYLSDGHQSGSCDTPHCLSCAMDDMFQEFYASETT
NGYTAANILSGFWISENKAFENLVANKEQDAHEFFQFMAEELHERNGDGKRPEIGSEHTC
NCIIHQTYYGKLQTSTTCQNCGGVTNQAQSFLDLSVPLENLTQKRGKKNLTNGDGVASTR
TQNSVTLQECLDEEYIKSDKCEYRCQNCNSVQQARRQTSIKKLPNVLSIQLKRFEFKQGR
NDRAQKIETPVQFPLQLNMLPYTTRARTQDLKDNYELQRSCTYDLLCVVVHVGDMDTGHY
ISYCRVGDQWFAFNDHKVELAQKSDVLNAKAYLLFYIVRSLS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccaacgctgcgtcctccaaggaccacaaggtcaaggagccccagcccggccag
ccaatgtatggatgtgagcatgtcggccgtctctttaaccaagatcaagcgacgatcaac
atgtccatacaacattacaagaccattctgcgagccatcttcgacatcaaccctatcctg
tcacacacggccaagggcgtagatggccaggttgtaacatccattaccccaacctacctc
tgtctgcaatgcccctcgactctcaccgacgatgaccttacaaaacacggcaacaaaaaa
tcacatcgcttctatgttgagtcgaggagcggagcggtgtattgccaaatgtgtgatgat
attgtgtgggaccctacctttgaggatttgaggttaaagaagctcggcacagggtcgttt
ttcggtagccgaaagcgtaaacatgaggaactcttcgcccctgatcccgtaaaagacgct
ccccagtatatatcgaccaacaccaccctcgccacctgcaaggctaacggtctccgtggt
atctataatgccggagcaacttgctatcaaaacgttgtcctccaatcattcctccacaat
cccatactacgcaacttctacctgagtgatgggcatcagtcaggcagttgcgacacaccc
cattgcctcagttgtgccatggacgatatgttccaggaattttatgccagcgaaacgacg
aacggttataccgccgcaaatatcttgtccggattctggatcagcgagaacaaggcgttt
gagaacttggtagccaacaaggagcaagatgctcatgagtttttccagttcatggctgag
gaattacacgagagaaatggcgacggcaagagaccggaaattggcagtgagcatacctgc
aactgcatcatccaccaaacatactacggaaagttacagacgtccacaacgtgccaaaac
tgtgggggcgtcaccaatcaagcccagagctttttggatctcagtgttcccttggaaaat
ttgacgcaaaaaaggggcaagaagaacttgacgaatggcgacggggtcgcatcgacaaga
acgcaaaacagcgtgactctccaggaatgcttggacgaagaatacatcaaatccgataag
tgcgagtatcggtgtcagaactgcaattcagtacagcaagcaagaagacagaccagtatc
aagaaattacccaacgttctttctatccagctcaagaggttcgagttcaaacaagggcgt
aatgatcgtgcccagaagatcgagacacctgtccagtttcctttacaactcaacatgctg
ccttatacgacacgcgcacgaacacaggatctcaaagataactacgagctacagcggtcc
tgcacttacgatcttctatgcgttgttgtgcacgttggcgacatggataccggacactac
atttcttattgccgggttggcgaccagtggttcgcatttaacgatcacaaagttgaactg
gcccagaagtctgatgtgctaaacgcaaaggcctatcttctcttttacattgttcggtcc
ctgtcttga

DBGET integrated database retrieval system