KEGG   Neurospora crassa: NCU02393Help
Entry
NCU02393          CDS       T01034                                 

Gene name
mak-2
Definition
(RefSeq) mitogen-activated protein kinase-2
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ncr  Neurospora crassa
Pathway
MAPK signaling pathway - yeast
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NCU02393 (mak-2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    NCU02393 (mak-2)
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     NCU02393 (mak-2)
Protein kinases [BR:ncr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   NCU02393 (mak-2)
Chromosome [BR:ncr03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     NCU02393 (mak-2)
Exosome [BR:ncr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NCU02393 (mak-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Linkage Group VII; VII
AA seq 352 aa AA seqDB search
MSSAQRGGARKISFNVSEQYDIQDVVGEGAYGVVCSAVHKPSGQKVAIKKITPFDHSMFC
LRTLREMKLLRYFNHENIISILDIQKPRSYETFNEVYLIQELMETDMHRVIRTQELSDDH
CQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASQEDNSGFMT
EYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDVLG
TPTMEDYYGIKSRRAREYIRSLPFKKKVPFRTLFPNTSELALDLLEKLLAFNPVKRITVE
EALKHPYLEPYHDPDDEPTAPPIPEEFFDFDKHKDNLSKEQLKQLIYQEIMR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgcacaaagaggcggagctcgcaagatctccttcaacgtcagcgagcagtac
gacatccaggatgtcgtaggtgaaggcgcctatggtgtcgtctgctctgcagtacacaag
ccttcgggccaaaaggtcgctatcaaaaagatcaccccttttgaccactccatgttctgt
ttgcggacgttgcgcgagatgaagctgcttcggtacttcaaccacgaaaacatcatctct
atcctcgatatccaaaaaccacggagctacgagaccttcaacgaagtgtatctcatccag
gaactgatggagactgacatgcaccgcgtcattcgtacccaagagctctcggacgaccat
tgccaatacttcatttaccagacgctgcgcgccctcaaggccatgcactctgccaatgtt
cttcaccgcgacttgaaaccctccaaccttttgttgaacgccaactgcgatttgaaagta
tgcgacttcggtttggctcgctcggccgcgtcgcaagaggacaactcgggcttcatgacg
gaatacgttgccacccgttggtaccgcgcccccgaaattatgttgacgttcaaggagtac
accaaagccattgatgtctggtctgtcggctgcattttggccgagatgctgagcggcaag
ccactcttccctggcaaggattaccaccaccaactgaccctcatcctggacgtcctcggc
acgccaaccatggaggactactatggcatcaagtcgcgtcgggcgcgcgaatacatccgc
tcgctacccttcaagaagaaggttccctttcgcacgctgttccccaacacgtcggagctg
gccctggacctgctagagaagctccttgccttcaaccctgttaagcgcatcacggtcgaa
gaggcgctcaagcacccgtacctggagccctaccacgacccggatgatgagccgaccgcg
ccccccatccccgaggagttctttgatttcgataagcacaaggataacctgagcaaggag
cagttgaagcagttgatctaccaggagattatgaggtga

DBGET integrated database retrieval system