KEGG   Neurospora crassa: NCU02393Help
Entry
NCU02393          CDS       T01034                                 

Definition
mitogen-activated kinase-2
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ncr  Neurospora crassa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
VII
AA seq 354 aa AA seqDB search
MSSAQRGGARKISFNVSEQYDIQDVVGEGAYGVVCSAVHKPSGQKVAIKKITPFDHSMFC
LRTLREMKLLRYFNHENIISILDIQKPRSYETFNEVYLIQELMETDMHRVIRTQELSDDH
CQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASQEDNSGFMT
EYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDCMYHHQLTLILDV
LGTPTMEDYYGIKSRRAREYIRSLPFKKKVPFRTLFPNTSELALDLLEKLLAFNPVKRIT
VEEALKHPYLEPYHDPDDEPTAPPIPEEFFDFDKHKDNLSKEQLKQLIYQEIMR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgcacaaagaggcggagctcgcaagatctccttcaacgtcagcgagcagtac
gacatccaggatgtcgtaggtgaaggcgcctatggtgtcgtctgctctgcagtacacaag
ccttcgggccaaaaggtcgctatcaaaaagatcaccccttttgaccactccatgttctgt
ttgcggacgttgcgcgagatgaagctgcttcggtacttcaaccacgaaaacatcatctct
atcctcgatatccaaaaaccacggagctacgagaccttcaacgaagtgtatctcatccag
gaactgatggagactgacatgcaccgcgtcattcgtacccaagagctctcggacgaccat
tgccaatacttcatttaccagacgctgcgcgccctcaaggccatgcactctgccaatgtt
cttcaccgcgacttgaaaccctccaaccttttgttgaacgccaactgcgatttgaaagta
tgcgacttcggtttggctcgctcggccgcgtcgcaagaggacaactcgggcttcatgacg
gaatacgttgccacccgttggtaccgcgcccccgaaattatgttgacgttcaaggagtac
accaaagccattgatgtctggtctgtcggctgcattttggccgagatgctgagcggcaag
ccactcttccctggcaaggattgtatgtaccaccaccaactgaccctcatcctggacgtc
ctcggcacgccaaccatggaggactactatggcatcaagtcgcgtcgggcgcgcgaatac
atccgctcgctacccttcaagaagaaggttccctttcgcacgctgttccccaacacgtcg
gagctggccctggacctgctagagaagctccttgccttcaaccctgttaagcgcatcacg
gtcgaagaggcgctcaagcacccgtacctggagccctaccacgacccggatgatgagccg
accgcgccccccatccccgaggagttctttgatttcgataagcacaaggataacctgagc
aaggagcagttgaagcagttgatctaccaggagattatgaggtga

DBGET integrated database retrieval system