KEGG   Neurospora crassa: NCU02395Help
Entry
NCU02395          CDS       T01034                                 

Definition
(RefSeq) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ncr  Neurospora crassa
Pathway
ncr00860  Porphyrin and chlorophyll metabolism
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NCU02395
Enzymes [BR:ncr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NCU02395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 3875862
NCBI-ProteinID: XP_959715
UniProt: Q7S4P0
Position
Linkage Group VII; VII
AA seq 303 aa AA seqDB search
MSQKTPVFLLKTKSTPGDSYQEQFSSETDGFNFEPFFVPVLEHRFKDEGLATVRNLLKTK
AIGTGFDCAYGGLVFTSQRAVEAFTHLVQEVTGDDRWPHLQDIPVYSVGPATTRALKAVP
QRPPLQVFGEHTGNGETLAPYIIEHYGEWYKDRSIKPPLLFLVGEQRRDIIPKKLMDPAL
PSDKFIRIKEVVVYGTGVMKSFQQDFTKLLQETQDRPARWVVVFSPSGCDGMLSALGWLN
ESSGRVGDDFQQEDRKTYIATIGPTTRLHLVKNFGYEPDVCAEQPSPEGVWQGISRFWNE
AKK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaaagacccccgtctttctgttgaagacaaaatccactcctggggactcgtac
caggagcaattctcttccgagacggatggctttaatttcgagcctttctttgttcccgtt
ctggaacatcgattcaaggacgagggcttagctacggtgcgcaatcttctcaagacgaaa
gctataggaactggcttcgactgtgcttacggaggtctggtcttcacctcccaacgtgcc
gttgaagccttcacccacctcgtccaagaagtaacaggcgatgacaggtggccccatctc
caagatatccctgtttacagcgtcggccctgcgacaacccgtgcgttaaaggcagttccc
caacgaccgccgctccaagtctttggtgagcatactggcaacggtgaaacattggcaccc
tacatcatcgaacactatggcgaatggtataaagaccggtccatcaagccgccgctgttg
tttctggttggcgagcaaaggcgggatataattcccaagaagttgatggaccctgcttta
ccatcagacaagttcattcgcatcaaagaggtcgtcgtctatggtaccggtgttatgaaa
tccttccaacaagatttcacaaagcttctccaagagacccaagaccggccggcgagatgg
gtcgtggtgttctccccaagtggctgcgacggcatgcttagtgccctgggatggctgaac
gagagtagcggcagagtgggagacgactttcaacaggaggataggaaaacgtacattgct
accatcggaccgacaactcgccttcatcttgtcaagaactttggctatgagcctgatgtc
tgcgcggagcaacccagcccggaaggggtttggcagggtatcagtaggttttggaacgaa
gcaaagaaatag

DBGET integrated database retrieval system