KEGG   Neurospora crassa: NCU02435Help
Entry
NCU02435          CDS       T01034                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
ncr  Neurospora crassa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 137 aa AA seqDB search
MPPKPADKKPASKAPATASKAPEKKDAGKKTAASGDKKKRTKARKETYSSYIYKVLKQVH
PDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAKH
AVSEGTKAVTKYSSSTK
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaagcccgccgacaagaagcctgcctccaaggcccccgctactgcctccaag
gcccccgagaagaaggatgccggaaagaagactgccgcctctggcgacaagaagaagcgc
accaaggcccgcaaggagacctactcctcctacatctacaaggtcctcaagcaggtccac
cctgataccggtatctccaaccgcgccatgtctatcctgaactcgtttgtcaacgatatc
ttcgagcgcgttgccaccgaggcttccaagcttgctgcctacaacaagaagtccaccatc
tcctctcgtgagatccagacctctgttcgcctcatcctccccggcgagcttgccaagcac
gctgtatcggaaggcactaaggccgttaccaagtactcttccagcacgaaataa

DBGET integrated database retrieval system