KEGG   Neurospora crassa: NCU02438Help
Entry
NCU02438          CDS       T01034                                 

Definition
similar to 2-oxoglutarate dehydrogenase complex E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ncr  Neurospora crassa
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCU02438
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCU02438
  Amino acid metabolism
   00310 Lysine degradation
    NCU02438
Enzymes [BR:ncr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NCU02438
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 423 aa AA seqDB search
MLYKGLRLAARAAPKLALCNATPALRQLPLQFQHVRTYADQVIKVPQMAESISEGTLKQW
NKKVGDYVEQDEEIATIETDKIDVAVNAPEAGTIKEFLVNEEDTVTVGQDIVRLELGGAP
KEGGAEKPAASESKEAAPKDSAPAPEKAPEPKKETKPAAAPAPTPAKKETPAPKQESTPA
KEAPAALGNREERRVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSGLMDFRKQYKDEI
LKKTGVKLGFMSAFSRACVLAMRDIPAVNASIEGPNGGDTIVYRDYVDISVAVATEKGLV
TPVVRNVEAMDLVGIEKSIADMGKKARDGKLTIEDMAGGTFTISNGGVFGSLMGTPIINL
PQSAVLGLHAIKERPVAVNGKVEIRPMMYLALTYDHRLLDGREAVQFLVKVKEYIEDPRK
MLL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacaaaggtcttcgtcttgcggctcgcgccgctcccaaactcgcgctctgcaat
gcgacgcccgcactccggcagcttcccctgcagttccagcatgtccgcacctacgccgat
caggtcatcaaagtcccccaaatggccgagtccatcagtgagggtaccttgaagcagtgg
aacaagaaggttggcgactatgtcgagcaggacgaagagatcgcgaccatcgagaccgac
aagatcgatgttgccgtcaacgctcccgaggccggtaccattaaggagttcctcgtcaat
gaggaggacactgtcacagtcggccaggacatcgtccggttagagcttggtggtgcgccc
aaagagggcggtgccgaaaagccggccgcgtccgagagcaaggaggctgctcccaaggac
agcgctcctgctcctgagaaggctccggagcctaagaaggagaccaagcccgccgctgct
cctgctcctacgcccgccaagaaggaaactcctgcccccaaacaggagagtactcctgcg
aaggaggccccggctgcattgggcaatcgcgaggagcgcagagtcaagatgaaccgcatg
cgcctccgcatcgccgagcgtctcaagcagtcccagaacacggctgcctcgcttaccaca
ttcaacgaagttgacatgtcgggcctgatggatttccgcaagcagtacaaggacgagatc
cttaagaagaccggtgtcaagctcggcttcatgagtgccttttcccgcgcatgtgtcttg
gccatgcgcgatatcccggccgtaaatgcctcgattgagggtcccaatggcggtgacacc
attgtctatcgggactatgttgacatcagtgtcgctgtggccaccgagaagggtcttgtc
actcccgtagtccgcaatgttgaagccatggacctcgttggcattgagaagtccatcgct
gatatgggcaaaaaggctcgtgatggtaagctcaccattgaggacatggccggtggcact
ttcaccattagcaacggaggcgtttttggctccttaatgggtaccccgatcatcaatctt
cctcagagcgcagttttgggtctccatgctatcaaggagcgacctgttgctgttaatgga
aaggttgaaattcgccccatgatgtacttggctctcacctacgaccacaggctgcttgat
ggcagggaggctgtccagtttctggttaaggtgaaggagtacattgaggaccccaggaag
atgcttctttag

DBGET integrated database retrieval system