KEGG   Neurospora crassa: NCU02438Help
Entry
NCU02438          CDS       T01034                                 

Definition
(RefSeq) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ncr  Neurospora crassa
Pathway
ncr00020  Citrate cycle (TCA cycle)
ncr00310  Lysine degradation
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
ncr01130  Biosynthesis of antibiotics
ncr01200  Carbon metabolism
Module
ncr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ncr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCU02438
  Amino acid metabolism
   00310 Lysine degradation
    NCU02438
Enzymes [BR:ncr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NCU02438
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H DUF2868
Motif
Other DBs
NCBI-GeneID: 3875590
NCBI-ProteinID: XP_959443
UniProt: Q7S3Y3
Position
Linkage Group VII; VII
AA seq 423 aa AA seqDB search
MLYKGLRLAARAAPKLALCNATPALRQLPLQFQHVRTYADQVIKVPQMAESISEGTLKQW
NKKVGDYVEQDEEIATIETDKIDVAVNAPEAGTIKEFLVNEEDTVTVGQDIVRLELGGAP
KEGGAEKPAASESKEAAPKDSAPAPEKAPEPKKETKPAAAPAPTPAKKETPAPKQESTPA
KEAPAALGNREERRVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSGLMDFRKQYKDEI
LKKTGVKLGFMSAFSRACVLAMRDIPAVNASIEGPNGGDTIVYRDYVDISVAVATEKGLV
TPVVRNVEAMDLVGIEKSIADMGKKARDGKLTIEDMAGGTFTISNGGVFGSLMGTPIINL
PQSAVLGLHAIKERPVAVNGKVEIRPMMYLALTYDHRLLDGREAVQFLVKVKEYIEDPRK
MLL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacaaaggtcttcgtcttgcggctcgcgccgctcccaaactcgcgctctgcaat
gcgacgcccgcactccggcagcttcccctgcagttccagcatgtccgcacctacgccgat
caggtcatcaaagtcccccaaatggccgagtccatcagtgagggtaccttgaagcagtgg
aacaagaaggttggcgactatgtcgagcaggacgaagagatcgcgaccatcgagaccgac
aagatcgatgttgccgtcaacgctcccgaggccggtaccattaaggagttcctcgtcaat
gaggaggacactgtcacagtcggccaggacatcgtccggttagagcttggtggtgcgccc
aaagagggcggtgccgaaaagccggccgcgtccgagagcaaggaggctgctcccaaggac
agcgctcctgctcctgagaaggctccggagcctaagaaggagaccaagcccgccgctgct
cctgctcctacgcccgccaagaaggaaactcctgcccccaaacaggagagtactcctgcg
aaggaggccccggctgcattgggcaatcgcgaggagcgcagagtcaagatgaaccgcatg
cgcctccgcatcgccgagcgtctcaagcagtcccagaacacggctgcctcgcttaccaca
ttcaacgaagttgacatgtcgggcctgatggatttccgcaagcagtacaaggacgagatc
cttaagaagaccggtgtcaagctcggcttcatgagtgccttttcccgcgcatgtgtcttg
gccatgcgcgatatcccggccgtaaatgcctcgattgagggtcccaatggcggtgacacc
attgtctatcgggactatgttgacatcagtgtcgctgtggccaccgagaagggtcttgtc
actcccgtagtccgcaatgttgaagccatggacctcgttggcattgagaagtccatcgct
gatatgggcaaaaaggctcgtgatggtaagctcaccattgaggacatggccggtggcact
ttcaccattagcaacggaggcgtttttggctccttaatgggtaccccgatcatcaatctt
cctcagagcgcagttttgggtctccatgctatcaaggagcgacctgttgctgttaatgga
aaggttgaaattcgccccatgatgtacttggctctcacctacgaccacaggctgcttgat
ggcagggaggctgtccagtttctggttaaggtgaaggagtacattgaggaccccaggaag
atgcttctttag

DBGET integrated database retrieval system