KEGG   Neurospora crassa: NCU02468Help
Entry
NCU02468          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ncr  Neurospora crassa
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ncr00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 509 aa AA seqDB search
MGDSHTQSSSNGPDSRMRRNTATSSVPSSGITSSSSAALPPQRRTVKREKSGNPKNMNGP
LYMQRNENIVLVRRVKRKGEGPLKQLTRWFVENQIGFAFNLLALLFLAHGCMPRARSHTG
KYFTLSYYNPTTGQYGLGKDDGFLIFFCIILFTGLRAATLEYLFAPYAKSKGISKRKDIT
RFSEQAWLLIYYSVFWTLGLYIYWQSPHFFNLRELWTNWPNRELTGIMKGYMLAQLAFWL
QQILVINIEERRKDHWQMFTHHIITICLIYASYRYGHTRVGNLILVLMDVVDLFLPLAKC
LKYLGHSSACDFMFVVFMVSWFVARHVLYLTVCYSVYAHTTSIIPYGCFSGTPGNLKGPF
QPPADKGALYLLEPLWNPDGLVCYDDTVKWTFLSMLLFLQALTIMWFSLIIRVALRVLRG
EGADDTRSDDEGCEDVDAEDDEDETEFVYEEAQALAEEVGVDELDLKNWAERRRAGHGVG
GVTATGVSLPGHSDRKELLGRIGCEKQVE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggcgattcccatacccaaagctccagcaatggccccgactcacgaatgaggcggaat
accgcgacatcctccgttccctcctccggaattaccagcagcagcagcgcagctctccca
cctcagcggaggactgtcaaacgcgagaagtctggcaaccccaagaatatgaatggtccc
ctctacatgcagcgcaacgaaaacatcgttcttgttcgtcgcgtcaagaggaagggagag
ggccctctgaaacagctgacgcgctggttcgttgagaatcagatcggcttcgctttcaac
ctccttgccctcctcttcctcgcccatggatgtatgcctcgcgcccgctcccataccgga
aagtacttcacgctctcgtactacaacccaacgaccggacaatacggcctcggcaaggat
gacggcttcctcatcttcttctgcatcattctctttaccggcctccgcgccgccacgctg
gaatacttgttcgcgccgtacgcaaagtccaagggcatttccaagaggaaggacatcacc
aggtttagcgaacaggcttggctcctgatctactacagcgtcttctggactctcggtctc
tacatctattggcaatcaccgcacttcttcaacctccgagagctctggacgaactggccc
aaccgcgagctcaccgggattatgaagggatacatgcttgcccagcttgccttctggctg
cagcaaatcttggtcatcaacattgaggagcgcagaaaggaccattggcagatgtttacg
catcacatcatcaccatctgcctcatctacgcctcttacagatacggccacacccgcgtg
ggcaaccttatccttgtcctgatggacgttgtagatttgttccttccgctcgccaagtgc
ctcaaatacctcggccactccagcgcctgcgacttcatgttcgtagtcttcatggtttcc
tggttcgtcgcccgccatgttttgtatctgacggtctgctactccgtctacgctcatacg
acctccatcattccgtacggctgcttctctggtactcccggaaacctgaagggtcccttc
cagccgcccgctgacaaaggcgctctctacctgctcgagccgctctggaaccccgacgga
ctggtgtgctatgatgacacggtcaagtggaccttcctctcgatgctgctcttcttgcag
gcgttgaccatcatgtggttttcactcatcatccgcgtggctctacgcgtgctcaggggc
gaaggagctgatgatacgcgcagtgatgacgaaggttgtgaagatgttgatgcagaggat
gacgaggatgaaactgagtttgtttacgaggaggctcaagcgctggcggaggaggttggt
gttgatgagcttgacctcaagaactgggcggagagaagacgtgccggtcacggcgtcggc
ggagtgactgccaccggcgtgagtctgcctggtcatagtgatcggaaggaactgctcgga
cggattgggtgtgagaagcaggttgagtaa

DBGET integrated database retrieval system