KEGG   Neurospora crassa: NCU02510Help
Entry
NCU02510          CDS       T01034                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
ncr  Neurospora crassa
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NCU02510
Exosome [BR:ncr04147]
 Exosomal proteins
  Proteins found in most exosomes
   NCU02510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 1678 aa AA seqDB search
MAQALPIKFQELLQLSALGINQTAITFNTCTLESDNWVCIRDKKDEAASPEVIIVDLKNG
NNVIRRPIKADSAIMHWTRQVIALKAQARTLQIFDLENKAKLKSTNMSEDVLFWKWVSET
TLGLITDGSVYHWDVFDPNQPAPVKVFDRNANLQGNQIINYRTSADGKWMVVVGISQQQG
RVVGAMQLYSKDRGISQAIEGHAAAFGTLRLEGAPEDTKVFTFAVRTAVGAKLHIVEVDH
PETNPVFPKKAVDVFFPPEASNDFPVALQVSQKYGIIYLITKYGFIHLYDLETATCIFMN
RISSDTIFTACGDKDSTGVIGINRKGQVLFVSADENTIVPYVLEAHGNELAIKLASRAGL
PGADNLYQQRFEQLFSNGNYQEAAKVAANSPRGFLRTPQTIERFKRLPQQPGQMSHILQY
FGMLLDKGSLNEHETIELAQPVLAQNRKQLLQKWLSENKLECSERLGDMVRPHDINMALA
IYLKANAPHKVVAGFAETGQFEKILPYCGQANYQPDFIQLLHHIVRVNAEKGAEFATTLA
NHEGGPLVDFEKVVDIFQSQGMIQQATAFLLDALKDNKPEHAHLQTRLLEMNLVNAPQVA
DAILGNDMFSHFDKAHIANLCEQAGLLQKALELYEDPASIKRVIVNIPGMPNYNPEWLIE
YFKALSVEQSLDCLDAMMKHNIRQNLQTVVQVATKYAELLGAQQLIDLFEKYKTAEGLYY
FLASVVNVTEDPEVVFKYIEAATKMGQIREVERICRDNSVYNPEKVKNFLKEAKLSEMLP
LMVVCDRFNFVHDLVLYLYQHQQFKSIEIYVQQVNPSRTPGVIGGLLDVDCDESIIRNLL
STVNPASIPIDELVQEVETRNRLKLLLPFLEATLAAGNQQQAVYNALAKIYIDSNNNPEK
FLKENDQYDTLTVGKYCEKRDPNLAYIAYRKGQNDLELVNITNENQMYKAQARYLLERAD
RELWMFVLSENNVHRRSVVDQVISTAVPESTDPAKVSEAVTCFLNADLPGELIELLEKIV
LEPSPFSDNQNLQNLLIFTAAKADKARVMDYIHKLDNFAADEIANVCIEVGLHEEAFEVY
KKIDNKEAAVNVLVEHVVSIDRAQAYAEEVDIPQVWSKVAKAQLDGLRVSDSIESYIKAE
DPKNYEEVIEVAVAAGKNEELIKYLRMARKTLREPVIDTALAFCYARLDQLPELEEFLRA
TNVANVEESGDKAYAEGFFEAAKIFYTSISNWAKLATTLVHLSDYQAAVDCARKANNIKV
WKEVHEACVNKKEFRLAQICGLNLIVDAEQLQALVKQYETNGYFDELISLLEQGLGLERA
HMGMFTELGIALSKYHPERLMEHLKLFWSRMNLPKMIRACEEANLWPELVFCYYHYDEFD
NAALAVMERPENSWEHQQFKEITVKVANLEIYYKAINFYLEQHPSLLTDLLQVLTPRIDV
NRVVRMFQKSDNLPLIKPFLLSVQSQNKRTVNDAINDLLIEEEDYKTLRDSVNNYDNYDA
VDLAGRLEKHDLVFFRQIAASIYRKNKRWEKSINLSKQDKLWKDAIETAAISGKTEVVEE
LLRYFVDIGNRECYVGMLYACYDLIRPDLVLELSWRNGLNDFTMPYMINMLCQQTKELAS
LKADNEARKAKEQEKEKVEDNTPILGNRLMITAGPGQASPAPYGQTNGFVPQPTGFGF
NT seq 5037 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggccctacccatcaaattccaggagctgctgcaactcagcgccctcggcatc
aaccagactgccatcactttcaatacctgtactctagaatcggacaactgggtgtgtatt
cgcgacaagaaggacgaggcagcgtcccctgaagtcatcatcgtcgatctcaagaacggc
aataatgttatccgacgtcccatcaaggccgacagtgccataatgcactggacgcgccaa
gtaattgccctcaaggcccaggcgcgcacactccagattttcgacctcgaaaacaaggcc
aagctcaagtcgacaaacatgagcgaggatgtcttgttctggaagtgggttagcgagacc
acgcttggcttgatcacagatggctctgtttaccattgggatgtcttcgacccgaaccag
cccgctccggtcaaggtcttcgatcgtaatgctaatctccagggcaaccaaataattaat
tatcggaccagcgccgacggaaagtggatggttgttgtcggtatctcacaacagcagggc
cgcgttgttggcgccatgcagctctattccaaagaccgcggtatcagccaggctattgag
ggtcatgccgctgcttttggcaccctccgactagagggcgccccggaggacaccaaggtg
tttacctttgcggtccgcaccgccgtcggcgcgaagctccacattgtcgaggtcgaccat
cccgaaacaaaccccgtcttccccaagaaggccgtggacgtcttcttccctcccgaggcc
agcaatgacttccccgtcgccctccaggtttcgcaaaagtacggcatcatctaccttatc
accaagtacggtttcatccacctctacgacctcgagactgccacatgtatcttcatgaac
cgcatctcaagcgatactatcttcactgcttgcggtgacaaggattcgaccggcgtcatt
ggcatcaaccgcaagggacaggttctcttcgtcagcgccgatgagaacacaatcgttcct
tacgtccttgaggcacacggcaatgagctcgctatcaagttggcttctcgtgcagggctc
ccaggcgccgataacctctaccagcaacgcttcgagcaactcttcagcaatggcaactac
caagaggccgccaaggtggctgccaactctcctcgaggtttccttcgcactcctcagacc
atcgagcgcttcaagcgtcttccacagcagcctggacagatgtcgcatatcttgcagtac
tttggtatgcttctagacaagggttcgctgaacgagcatgagaccattgagcttgcccaa
cccgttctcgctcagaaccgcaaacagctattgcagaagtggctcagcgagaacaagctc
gagtgctctgagagacttggtgacatggtccggccccacgacattaacatggcgcttgcc
atctatttgaaggccaacgctcctcacaaggttgttgctgggtttgccgagactggccag
tttgagaagattctgccctactgcggtcaagccaactaccagcctgactttattcagctt
ctccaccacattgtccgtgtcaatgctgagaagggtgccgagtttgccacgacgcttgcc
aatcacgaaggcggcccgctggtcgacttcgagaaggtggttgacatcttccagtctcaa
ggaatgatccagcaagcaactgctttccttcttgacgctctgaaggataacaagcccgag
catgcccaccttcagactcgtctattggagatgaacctcgtcaacgccccccaggttgct
gacgccattcttggcaacgacatgttctcccactttgacaaggcgcacattgcgaacctc
tgcgagcaagcaggtcttttgcagaaggccctggagctctatgaggatcctgcgtccatc
aagcgggttattgtcaacatccctggaatgcctaactacaaccccgagtggttgattgag
tatttcaaggcgctgtctgttgagcaatcgcttgactgcctggacgccatgatgaagcac
aatattcgccagaatctccagactgtcgttcaagtcgcaaccaagtatgcggagctcctc
ggcgcgcagcaattgattgatctctttgagaagtacaagactgctgaaggtctttactac
ttccttgccagtgtcgtcaatgtcaccgaggaccccgaagtcgtattcaagtacattgag
gctgccaccaagatgggacaaattcgcgaggttgagcgtatctgccgcgacaacagcgtt
tacaaccccgagaaggtgaagaacttcctcaaggaggccaagctcagcgagatgcttcct
ttgatggttgtctgcgatcgcttcaactttgttcatgacctggttctctacctgtaccag
caccagcagttcaagtccattgagatttacgtgcagcaggtcaacccgagcaggactcct
ggtgtcatcggaggactgctcgatgtggactgtgatgaaagcatcatcaggaatctccta
agcacggtcaaccccgcatctatccctatcgatgagctggtgcaggaggttgagactcgt
aaccgccttaagctactcctgcccttcctggaggctaccctcgctgccggtaaccagcag
caggctgtttacaacgctctcgccaagatatacattgactccaacaacaacccagagaag
ttcctcaaggagaacgatcagtatgataccctcactgttggaaagtactgcgagaagcgt
gatcccaacttggcctatattgcctatcgcaagggccagaatgatctcgaactcgtgaac
atcaccaacgagaaccagatgtacaaggctcaggcgaggtatcttttggagcgcgctgat
agggaactttggatgtttgtgctcagcgagaacaacgttcaccgccgttctgtcgtagac
caagtcatctcgacggccgttcctgagtcgactgatcccgccaaggtttccgaggctgtt
acgtgcttcctgaacgccgacttgcctggcgagcttattgagctgctggagaagattgtc
ctggagccgtcgcctttcagcgacaaccagaacctgcagaacttgcttatcttcactgcc
gccaaggctgacaaggcccgtgtgatggactacattcacaagctcgacaacttcgccgcc
gacgagattgctaatgtttgtattgaggttggcctgcacgaggaagcctttgaggtctac
aagaagattgacaacaaggaggccgctgtcaatgttcttgttgagcacgtcgttagcatt
gaccgtgctcaagcatacgccgaggaggttgatattcctcaggtttggagcaaagttgcc
aaggctcagcttgatggtctccgcgtcagcgattccattgaatcttacatcaaggccgag
gatccgaagaactacgaggaagtgatcgaggttgccgttgctgctggaaagaacgaagag
ctcatcaagtacctccgtatggcccgcaagacccttcgggagcctgtcattgacactgct
cttgctttctgctacgcccgcctcgatcaacttcctgagcttgaagagttcctgcgtgct
accaatgttgccaatgttgaggagtctggtgacaaggcgtacgccgagggcttctttgag
gcggccaaaatcttctacaccagcatttccaactgggctaagctggccactactcttgtc
cacctgtccgactaccaggcggctgtggactgcgcccgcaaggccaacaacatcaaggtg
tggaaggaggtccacgaggcctgcgtcaacaagaaggagttccgtcttgctcagatttgc
ggtctcaaccttattgttgatgctgagcaactccaggctcttgtcaagcagtacgagaca
aacggctactttgatgagctcatcagcttgctcgagcagggtcttggattggagcgcgcc
cacatgggaatgttcaccgagttgggtattgcgctgtctaaataccaccccgagcgcctt
atggagcacctcaaactcttttggagcagaatgaacctccccaagatgatccgtgcttgc
gaggaagccaacttgtggcctgagctggtcttctgctactaccactacgatgagtttgac
aatgctgctctcgccgttatggagcgccctgagaactcttgggagcaccagcagttcaag
gagatcaccgtcaaggtggccaaccttgaaatctactacaaggccatcaatttctacctg
gagcaacatccctcgttgctcaccgatcttctccaggttttgaccccgcgcatcgatgtc
aaccgtgttgtccgcatgttccagaagtccgataacctgcccctgatcaagcctttcctc
cttagcgtccaatctcagaacaagcggaccgttaacgacgccatcaatgatcttctcatt
gaggaggaggactacaagactctgcgcgactctgtgaacaactacgacaactacgacgcc
gtggaccttgccggtcgtctggagaagcacgaccttgtcttcttccgccaaattgctgcc
agcatctaccgcaagaacaagcgctgggagaagtccatcaacctttccaagcaggataag
ctctggaaggatgctattgagacggccgccatctccggcaagacggaagttgtcgaggag
cttctgcgctacttcgttgacattggcaaccgcgaatgctacgttggtatgctttatgcc
tgctatgacctcatcaggcccgaccttgtcctggagctttcttggcgcaatggtctcaat
gattttaccatgccttatatgatcaacatgctctgccagcagaccaaggagctcgcttct
ctgaaggccgacaacgaggctcgcaaggctaaggagcaggagaaggagaaggtcgaggac
aacacgcccattcttggcaaccggcttatgatcactgccggccccggccaggcatcccca
gctccttacggacaaaccaacggttttgtgccgcagcctaccggttttggcttctag

DBGET integrated database retrieval system