KEGG   Neurospora crassa: NCU02797Help
Entry
NCU02797          CDS       T01034                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ncr  Neurospora crassa
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NCU02797
   00052 Galactose metabolism
    NCU02797
   00500 Starch and sucrose metabolism
    NCU02797
   00520 Amino sugar and nucleotide sugar metabolism
    NCU02797
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NCU02797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 521 aa AA seqDB search
MAQAIRSALPDRLMPSNGDEEFAKRHHGKTRSHMAFENTSTSIAAAQMRNALTKLAETVK
DPDQKKLFETEMDNFFSLFRRYLNDKAKGNEVNWDKIAPPAPHQIVDYESLANNNSVDFL
NKLAVLKLNGGLGTSMGCVGPKSVIEVRDGMSFLDMSVRQVEHLNRTYGSNVPILLMNSF
NTDDDTAAIIKKYEGHNVDILTFNQSRYPRIYKDSLLPVPKSFDSPLHDWYPPGHGDVFE
SLYNSGILDKLIERGIEIIFLSNADNLGAVVDLRILQHMVETDAEYIMELTNKTKADVKG
GTIIDYEGSVRLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWMNVQAVKRVVENNELELEI
IPNEKTIPGDKKGESDISIVQLETAVGAAIKHFKGAHGVNVPRRRFLPVKTCSDLMLVKS
DLYTVKHGQLQMSSARFGDAPLIKLGNDFKKVSDFQKRIPSIPKIIELDHLTITGAVNLG
RGVTLKGTVIIVATEGQTIDIPPGSILENVVVQGSLRLLEH
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagcaatcaggagcgccctccccgaccgcctcatgccttccaacggcgacgag
gagtttgccaagagacaccatggcaagactagatcccacatggctttcgagaacacctcc
acaagcattgccgctgcccagatgcgcaatgccctcacaaagcttgccgagacggtcaag
gaccccgaccagaagaagctcttcgagaccgagatggacaacttcttctcgctcttccgc
cgctacctgaacgacaaggccaagggcaacgaggtcaactgggacaagattgcccctcct
gcccctcaccagatcgtcgactacgagagcctcgctaacaacaactcggtcgacttcctc
aacaagcttgccgttctcaagctcaacggtggtctcggtacctccatgggctgcgtcggc
cccaagtccgtcatcgaggtccgtgatggcatgtccttcctcgacatgtccgtccgccag
gttgagcacctcaaccgcacctatggctccaacgtgcccatcctcctcatgaactcgttc
aacaccgatgatgacactgctgccatcatcaagaagtacgagggccacaatgtcgacatc
ctcaccttcaaccagtcccgctaccccagaatctacaaggactccctcctccccgtcccc
aagtcctttgactctcctctccatgactggtaccctcccggccacggtgacgttttcgag
tccctctacaactcgggtattctcgacaagcttattgagcgcggcatcgagatcatcttc
ctctccaacgccgacaacctcggtgccgtcgtcgacctccgcatcctccagcacatggtg
gagaccgatgccgagtacattatggagcttaccaacaagaccaaggccgacgtcaagggt
ggtaccattatcgactacgagggctccgtccgtctcctcgagatcgcccaggtccccaag
gagcacgtcaacgagttcaagtccatcaagaagttcaagtacttcaacaccaacaacatc
tggatgaacgtccaggccgtcaagcgtgtcgtcgagaacaacgagctcgagctcgagatc
attcccaacgagaagaccatccccggcgacaagaagggcgagtccgacatcagcattgtc
cagctcgagaccgccgtcggtgccgccatcaagcacttcaagggcgcccacggtgtcaac
gtgccccgtcgccgcttcttgcccgtcaagacctgctccgacctgatgctcgtcaagtcg
gatctctacactgtcaagcacggccagctccaaatgagctcggcccgcttcggtgacgct
cccctcatcaagcttggtaacgacttcaagaaggtgtcggacttccagaagcgcatcccc
agcatccccaagatcattgagcttgaccacctcaccattaccggtgccgtcaacctcggc
cgtggcgtcaccctcaagggtaccgtcattatcgtggccactgagggccagaccattgac
attcctcccggatccatcctcgaaaacgttgttgtccagggtagcttgcgcctccttgag
cactaa

DBGET integrated database retrieval system