KEGG   Neurospora crassa: NCU02855Help
Entry
NCU02855          CDS       T01034                                 

Definition
endo-1,4-beta-xylanase A precursor
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     NCU02855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 220 aa AA seqDB search
MVSLKSLLLGAAGALAMPFNATEFSELAERGGTPSSTGFNNGFYYSFWTDNGGNVNYANG
ASGSYSVNWQNAGNFVAGKGWNPGSARTITYSGNFRPSGNGYLSVYGWTRNPLVEYYVVE
NFGSYNPSSGAQRLGSVYTDGSTYDIYKTTRYNQPSIDGTRTFNQYWSVRQQKRTGGTVT
MANHFNAWAKAGLHLGTHNYQIVATEGYQSSGSAQITVHG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggtctccctcaagtccctcctcctcggcgctgccggtgccctcgctatgcccttcaac
gccaccgagttctctgagctcgccgagcgtggcggtacccccagcagcaccggcttcaac
aacggcttctactactccttctggaccgacaacggcggcaatgtcaactacgccaacggc
gccagcggctcttactctgtgaactggcagaacgccggcaactttgtcgccggcaagggc
tggaaccccggttcggctcgcaccatcacctactcgggtaacttcagaccctcgggcaac
ggctacctgtccgtctacggctggactcgcaacccgcttgtcgagtactacgtcgtcgag
aactttggctcctacaacccttcgtcgggcgcccaacgtctcggatccgtctacaccgac
ggctccacctacgacatctacaagaccacccgctacaaccagccgtccattgacggcacc
cgcaccttcaaccagtactggtcggtccgccagcagaagcgcaccggtggtaccgtcacc
atggccaaccacttcaacgcgtgggccaaggctggcctgcacctgggcacccacaactac
cagatcgtggccactgagggataccagagcagtggctctgcccagatcaccgttcacggt
taa

DBGET integrated database retrieval system