KEGG   Neurospora crassa: NCU03112Help
Entry
NCU03112          CDS       T01034                                 

Definition
similar to NADH-cytochrome b5 reductase precursor
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ncr  Neurospora crassa
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NCU03112
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     NCU03112
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 343 aa AA seqDB search
MSLFVASTRSAFRAAAPIKRSFQTRRSYATEPSKGGSSSTILLGAAAVGLAGAGAYFFSG
AGAAKKAEASVKQVTEKITPGEIKKAFVGGDQGWLSLKLEEVELVNHNTKRLRFRLPEDD
MVSGLHVASAILTKFKPIDAEKAVLRPYTPISDESAQGYIDLLVKKYEGGPMSTYLHDMA
PGQRLDIKGPLPKYPWEANKHKHIALVAGGTGITPMYQLIRAIFNNPDDKTKVTLVFGNV
SEEDVLLKHELATIENHYPQRFRAFYVLDNPPKEWAGNKGYINKDLLKTVLPEPKNEDIK
IFVCGPPGMMNSISGNKKSPRDQGELTGILKELGYSPDQVYKF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgttcgttgctagcaccagatccgccttccgggctgccgcccccatcaagagg
tctttccagacccgccgctcctatgcgaccgagccttccaagggtggcagcagcagcacc
atcctcctcggtgctgccgctgttggtcttgccggcgccggcgcctactttttctccggc
gctggtgccgccaagaaggctgaggccagcgttaagcaggtgaccgagaagatcaccccc
ggcgagatcaagaaggccttcgtcggcggcgaccagggatggctcagcctcaagctcgag
gaggttgagctggtcaaccacaacaccaagcgcctgcgcttcagactccctgaggacgac
atggtgtctggcctccatgttgccagcgccatcctcaccaagttcaagcctatcgatgct
gagaaggctgtcctcaggccttacactcccatcagcgacgagagtgcccagggctacatt
gacctcctggtcaagaagtacgagggtggtcccatgagcacctacctccatgacatggct
cccggccagcgcctcgacatcaagggccctcttcccaagtacccctgggaggctaacaag
cacaagcacatcgccctcgttgctggcggcaccggtatcactcccatgtaccagctcatc
cgcgccatcttcaacaaccccgatgacaagaccaaggttactctcgtcttcggcaacgtt
agcgaggaggacgttctcctcaagcacgagctcgccaccatcgagaaccactacccccag
cgcttccgcgctttctacgtcctcgacaaccctcccaaggagtgggccggtaacaagggc
tacatcaacaaggacctcctcaagaccgtccttcctgagcccaagaacgaggatatcaag
atcttcgtctgcggcccacccggcatgatgaactccatctccggcaacaagaagagcccc
agggaccagggcgagctgaccggtatcctcaaggagctcggctactctcccgatcaggta
tacaagttctaa

DBGET integrated database retrieval system