KEGG   Neurospora crassa: NCU03141Help
Entry
NCU03141          CDS       T01034                                 

Definition
similar to lysophospholipase
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
ncr  Neurospora crassa
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NCU03141
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NCU03141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 653 aa AA seqDB search
MHLPSSLLIAAPLLANVSAEPIRIPQRDVSVVSTSQQLAVRALPDSPSGGYAPAVVDCPK
TKPTLRKAVDLSNEEKNWLSIRRKNTIQPMRDLLKRANITGFDSETFMNEAANNISQLPN
VAIAISGGGYRALMNGAGFVAAADNRIQNTTGAGGIGGLLQSSTYLAGLSGGGWLVGSLF
SNNFSSIETLLSENKVWDFENSIFKGPKEAGLSTVNRIQYWSEVAKEVAKKKDAGFETSI
TDYWGRALSYQLIGADMGGPAYTFSSIAQTDNFQKAETPFPILVADGRAPGDTIISLNAT
NYEFNPFETGSWDPTVYGFAPTKYLGANFSNGVIPSGGKCVEGLDQAGFVMGTSSTLFNQ
FLLANISSYDGVPDVLIEAVTSVLKEIGAKRDDVSQIIPNPFLDWNNRTNPNADTLELDL
VDGGEDLQNIPLNPLTQPVRAVDVIFAVDSSADVTNWPNGTALRATYERTFGSISNGTLF
PSIPDDWTFINLGLNNRPSFFGCDVKNFTLNANQKVPPLIVYVPNAPYTALSNVSTFDPS
YTMSQRNDIIGNGWNSATQGNGTLDSEWPTCVACAVISRSLDRLGRQTPAACKTCFERYC
WNGTVNSKDTGVYMPEFKIADAHALDSGAVAIGKMVNVWSSVVVGVVAATLLL
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcccttcgtcgctgctcatcgcagctcccttgctcgccaatgtatcggccgaa
cccattaggataccccaacgcgatgtctccgtggtatcaacatcacagcaacttgccgtt
cgagcactaccggattcgcccagcggtggatatgcccctgccgttgtagactgtcccaag
accaagccgacgctccggaaggccgtggatttgtcgaacgaggagaagaactggttgtcg
atccggaggaagaacaccatccagcccatgagggacctcctgaagagggccaacatcact
gggttcgattccgagacatttatgaatgaggccgccaacaacatctcgcaactgcccaat
gtcgccattgccatttcaggaggcggctatcgtgccctcatgaacggcgccggcttcgtt
gctgctgcggataaccgaattcaaaataccacgggcgcaggtggtattggaggcttgttg
cagtccagcacatatttggccggactttctggtggtggctggcttgtcggcagtttgttc
tccaacaacttcagcagcattgagaccctgctgagcgagaacaaagtctgggactttgag
aactccatctttaaagggcccaaggaggctggccttagtactgtcaaccgcattcagtac
tggtccgaagtggcaaaggaagttgccaagaagaaggatgctggcttcgagacaagtata
acagactactggggccgagcattgagttaccaactgatcggagccgatatgggcggcccg
gcttacaccttctccagcattgcccagaccgacaacttccagaaggccgaaacgccgttc
cctattctggtagctgacggccgcgcgcctggagacaccatcatctccctcaatgctacc
aactacgagttcaacccgttcgagacgggtagctgggacccgaccgtctatggctttgcg
ccgaccaagtacctcggcgccaacttcagcaacggcgtgatcccatcgggaggcaagtgc
gttgagggtctcgaccaagccggcttcgtcatgggcaccagcagcacgctcttcaaccag
ttccttttggccaacatctccagctacgacggtgtgcccgacgtgctcatcgaggccgtg
acttctgtcctcaaggaaatcggcgccaagagggacgacgtctcccaaatcatccctaat
ccgttcctggactggaacaaccggaccaaccccaacgccgacacgctcgagctcgacctg
gtcgacggcggcgaagatctgcagaatattccgctcaacccgctcacccaacccgtgcgc
gccgtggacgtcatcttcgctgtcgactcgtccgccgacgtgacaaactggcccaatggc
accgccctgcgagccacctacgagcgcactttcggctctatttccaacgggacactcttc
ccctcgatccccgacgactggacgtttataaacctaggcctcaacaaccgcccctctttc
ttcggctgcgatgttaagaactttaccttgaacgccaaccaaaaggttccccccttaatc
gtctatgtccccaacgcgccctataccgcgctgagcaacgtgtccaccttcgatccgtca
tacaccatgtctcagcgcaacgacatcatcggcaacggatggaactcagccacgcaggga
aacggcacgctggattcggagtggcccacttgcgtcgcctgcgcggttatcagcaggagc
ttagatcggttgggcaggcagacgccagccgcgtgcaagacttgctttgagaggtattgc
tggaatggcacagtgaactcaaaagatacaggggtttacatgcctgagttcaagattgcg
gatgcgcatgccctggactcgggtgctgttgctatcggaaagatggtgaatgtctggtcg
tcggttgtggtgggagttgtggcggctactttgttgttgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system