KEGG   Neurospora crassa: NCU03176Help
Entry
NCU03176          CDS       T01034                                 

Definition
(RefSeq) hypothetical protein
  KO
K00866  choline kinase [EC:2.7.1.32]
Organism
ncr  Neurospora crassa
Pathway
ncr00564  Glycerophospholipid metabolism
ncr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NCU03176
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     NCU03176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase Choline_kin_N APH
Motif
Other DBs
NCBI-GeneID: 3880722
NCBI-ProteinID: XP_011393104
UniProt: V5IR04
Position
I
AA seq 764 aa AA seqDB search
MYHDIDQMNRRMWAFQPMSCYQGKQGAVQIAEPETPSVEEHHVKKQFSAGVAKRLGGRPA
PTSNPSRTSLASGTSQADIDNSGSPTLLTASPAPMDESPAHGPHGRHRNKIDRISERLVA
QVAEWIQHEKTKRETRKTGKLLRRRKTPPIHVNGEPTVSSPTRLRSDSVSSDSSEVSLDR
LQKILNDGMSALGLDQVPQLGPRLGRRRSRRSLKAPPARTASSDTEFFDGDVVVPSCDVF
LDNSKTMSYSGGKATTDDTPSQASRREEKEKQAWLTFKNEIIRLAHTLRLKGWRRIPLNG
GETISVERLSGALTNAVYVVSPPPESILPPQEGKRQPEKVLLRVYGPQVEHLIDREIELG
VLKRLARKKIGPRLLGTFLNGRFEQYFNSTTLTPENLREPETSKQIAKRMRELHDGVELL
EHEKDEGPGVWRNWDRWLDQAEKTAMYLDSQVAAQLQESTRHKETWKTRGFVCGVEWPVF
RKMVQKYRKFLEDYYGSPTKIREKLVFAHNDTQYGNILRIRPDDKKSPLLQPANEHKQLI
VIDFEYAGANLAGLEFANHFSEWTYNYHDPVTPHVCDAAKYPTLEQQRRFIKAYVDHQPK
FPSVPGVSTPSVTPSSAETPRPGMLQSTNSASSIVEFMLDARVPPGGWKEEDARREAESE
KRIKELLEETRLWRVANSAQWVVWGIIQAKIPGLNDGAKDVVTAPAGSVPDEELEAEEEA
DAFDYLGYSQERAFFFWADCVRLGLITEKELPENVRCRLKFVEQ
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacgatatcgatcagatgaataggcggatgtgggcattccagcccatgtcgtgt
taccaagggaagcaaggggctgtgcagattgcggaacctgagactccttctgtggaagag
caccacgttaagaaacagttctctgcgggcgtagccaaaagacttggtggccgacctgca
cccacctcaaacccatcgagaacctcactcgcttcaggtaccagccaagcggacatcgac
aactccggcagtccgactttactgactgcatcacctgccccaatggatgagtctccggca
cacggtccacatggtcgtcaccgtaacaagatagaccggatcagtgagcgactggtcgcc
caagtggcggaatggattcagcatgaaaagaccaagagggaaactagaaagacagggaag
cttcttcgacggcgcaagacaccacccatccatgtgaacggagagcctaccgtctcctcg
cctacccgccttcgttcggattcagtcagttcagactcgagcgaggtttctttggacaga
ctgcaaaagatactcaatgacggcatgtctgctctcggcctagaccaggtcccgcagcta
ggcccccgtctcggacgcagacgatctaggaggagtctcaaggcgcctcctgcccgcaca
gcctcttccgacacggaattttttgatggcgatgtcgttgttcctagctgtgacgtgttc
ctcgacaactcgaagaccatgagttactcgggcggcaaggcgaccaccgatgatacgcct
tcacaagccagccgtagggaagagaaggagaagcaggcttggctgacgttcaaaaacgag
atcattaggctggcacacactcttaggttaaaggggtggaggcgcattccgctcaacggt
ggtgagacgatctctgttgagcgactcagcggagcgctgacgaacgctgtgtatgtggtg
tcaccgccccctgaatctattttgcctccgcaggagggtaagagacagccggaaaaggtc
ttgctcagagtctacggcccgcaagttgagcatttgatcgaccgagaaatcgaattgggc
gttctcaagcgcctggcgagaaagaagattggccctcggttgctcggtacttttttgaac
ggccgcttcgagcagtatttcaactccaccacgttgacgccagagaatcttcgtgagcct
gagacatccaaacaaatcgccaaacgcatgagagaactccatgacggcgttgagcttctt
gagcatgaaaaggatgaaggtcctggtgtctggagaaactgggataggtggctcgaccag
gctgagaagacggccatgtacctcgacagccaggttgcagcccagcttcaagaatccact
cgccacaaggagacttggaagactaggggtttcgtctgcggtgtcgagtggcccgtgttc
agaaagatggttcagaagtaccgcaagttccttgaggactattatggcagccctaccaaa
ataagggaaaagttggtctttgcccataatgatactcaatacggtaacattttgcgcatt
cggcccgacgataagaagtcgcctttgctgcagcccgccaacgaacacaagcagttgatc
gtcatcgattttgagtatgccggagcgaacttggccggcctggagtttgccaatcacttc
tccgaatggacctacaactatcacgaccctgttacgccacatgtttgcgacgctgccaag
tatccaaccctcgaacagcagcggcggttcatcaaggcctacgtggaccaccagccgaag
ttcccttcggtacctggtgtatcaacaccatcggtgacaccgtcaagcgcggagacgcct
aggcccggcatgcttcagagcaccaactcggcaagctccattgtggaattcatgttggac
gcccgcgtgccgccaggtgggtggaaagaagaggacgcccgtcgtgaagccgagtcggag
aagaggattaaggaactcttggaagaaacccggctctggcgggttgccaacagcgctcaa
tgggtggtatggggcatcatccaggcgaagattcccggactgaatgacggggcgaaagac
gtggtaacggcgcccgcaggcagcgtgcctgacgaggagcttgaggcggaagaggaggct
gatgcgttcgactacctgggctactcgcaggagagggcctttttcttttgggcggactgt
gtacgccttgggcttatcacagaaaaggagttgccggagaacgttcgttgcaggcttaag
tttgttgagcagtga

DBGET integrated database retrieval system