KEGG   Neurospora crassa: NCU03176Help
Entry
NCU03176          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
ncr  Neurospora crassa
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NCU03176
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     NCU03176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
I
AA seq 682 aa AA seqDB search
MDESPAHGPHGRHRNKIDRISERLVAQVAEWIQHEKTKRETRKTGKLLRRRKTPPIHVNG
EPTVSSPTRLRSDSVSSDSSEVSLDRLQKILNDGMSALGLDQVPQLGPRLGRRRSRRSLK
APPARTASSDTEFFDGDVVVPSCDVFLDNSKTMSYSGGKATTDDTPSQASRREEKEKQAW
LTFKNEIIRLAHTLRLKGWRRIPLNGGETISVERLSGALTNAVQPEKVLLRVYGPQVEHL
IDREIELGVLKRLARKKIGPRLLGTFLNGRFEQYFNSTTLTPENLREPETSKQIAKRMRE
LHDGVELLEHEKDEGPGVWRNWDRWLDQAEKTAMYLDSQVAAQLQESTRHKETWKTRGFV
CGVEWPVFRKMVQKYRKFLEDYYGSPTKIREKLVFAHNDTQYGNILRIRPDDKKSPLLQP
ANEHKQLIVIDFEYAGANLAGLEFANHFSEWTYNYHDPVTPHVCDAAKYPTLEQQRRFIK
AYVDHQPKFPSVPGVSTPSVTPSSAETPRPGMLQSTNSASSIVEFMLDARVPPGGWKEED
ARREAESEKRIKELLEETRLWRVANSAQWVVWGIIQAKIPGLNDGAKDVVTAPAGSVPDE
ELEAEEEADAFDYLGYSQERAFFFWADCVRLGLITEKELPENLDGFVRCEGVDVTCMASQ
GLHSVAVGSSLDMGKRCIYKHA
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggatgagtctccggcacacggtccacatggtcgtcaccgtaacaagatagaccggatc
agtgagcgactggtcgcccaagtggcggaatggattcagcatgaaaagaccaagagggaa
actagaaagacagggaagcttcttcgacggcgcaagacaccacccatccatgtgaacgga
gagcctaccgtctcctcgcctacccgccttcgttcggattcagtcagttcagactcgagc
gaggtttctttggacagactgcaaaagatactcaatgacggcatgtctgctctcggccta
gaccaggtcccgcagctaggcccccgtctcggacgcagacgatctaggaggagtctcaag
gcgcctcctgcccgcacagcctcttccgacacggaattttttgatggcgatgtcgttgtt
cctagctgtgacgtgttcctcgacaactcgaagaccatgagttactcgggcggcaaggcg
accaccgatgatacgccttcacaagccagccgtagggaagagaaggagaagcaggcttgg
ctgacgttcaaaaacgagatcattaggctggcacacactcttaggttaaaggggtggagg
cgcattccgctcaacggtggtgagacgatctctgttgagcgactcagcggagcgctgacg
aacgctgtacagccggaaaaggtcttgctcagagtctacggcccgcaagttgagcatttg
atcgaccgagaaatcgaattgggcgttctcaagcgcctggcgagaaagaagattggccct
cggttgctcggtacttttttgaacggccgcttcgagcagtatttcaactccaccacgttg
acgccagagaatcttcgtgagcctgagacatccaaacaaatcgccaaacgcatgagagaa
ctccatgacggcgttgagcttcttgagcatgaaaaggatgaaggtcctggtgtctggaga
aactgggataggtggctcgaccaggctgagaagacggccatgtacctcgacagccaggtt
gcagcccagcttcaagaatccactcgccacaaggagacttggaagactaggggtttcgtc
tgcggtgtcgagtggcccgtgttcagaaagatggttcagaagtaccgcaagttccttgag
gactattatggcagccctaccaaaataagggaaaagttggtctttgcccataatgatact
caatacggtaacattttgcgcattcggcccgacgataagaagtcgcctttgctgcagccc
gccaacgaacacaagcagttgatcgtcatcgattttgagtatgccggagcgaacttggcc
ggcctggagtttgccaatcacttctccgaatggacctacaactatcacgaccctgttacg
ccacatgtttgcgacgctgccaagtatccaaccctcgaacagcagcggcggttcatcaag
gcctacgtggaccaccagccgaagttcccttcggtacctggtgtatcaacaccatcggtg
acaccgtcaagcgcggagacgcctaggcccggcatgcttcagagcaccaactcggcaagc
tccattgtggaattcatgttggacgcccgcgtgccgccaggtgggtggaaagaagaggac
gcccgtcgtgaagccgagtcggagaagaggattaaggaactcttggaagaaacccggctc
tggcgggttgccaacagcgctcaatgggtggtatggggcatcatccaggcgaagattccc
ggactgaatgacggggcgaaagacgtggtaacggcgcccgcaggcagcgtgcctgacgag
gagcttgaggcggaagaggaggctgatgcgttcgactacctgggctactcgcaggagagg
gcctttttcttttgggcggactgtgtacgccttgggcttatcacagaaaaggagttgccg
gagaacctcgacggcttcgtgcgatgcgagggcgttgacgtgacctgcatggccagccag
ggcctgcatagcgtagcagttggtagttccctcgatatgggaaagcggtgtatctacaag
catgcgtga

DBGET integrated database retrieval system