KEGG   Neurospora crassa: NCU03297Help
Entry
NCU03297          CDS       T01034                                 

Definition
cytochrome c peroxidase, mitochondrial precursor
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     NCU03297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 358 aa AA seqDB search
MAASRTATRTLRALRTSTRPALTAAPRAAFRQGGRRLYSSEPAKSGGSNIWAWAIGAGAL
GAGGLWYLNQDGASATPKVFAPKFDDYQAVYNEIASRLEEKDDYDDGSYGPVLVRLAWHA
SGTYDKETGTGGSNGATMRFAPESDHGANAGLKAARDFLEPVKAKFPWITYSDLWILGGV
CAIQEMLGPQIPYRPGRQDRDAAGCTPDGRLPDASQAQDHLRNIFYRMGFNDQEIVALSG
AHALGRCHADRSGFDGPWTFSPTVLTNDYYKLLLDEKWQWKKWNGPKQYEDKKTKSLMML
PADMALIQDKKFKQWVEKYAADNELFFKDFSNVIVKLFELGVPFAENSERWVFKTVNA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctcccgcactgccacccgcactctccgcgctctgcgcacctcgactcgtcct
gcgctcactgccgcgccccgcgctgctttccgccagggtggtcgtcgtctttactcttct
gagcccgccaagtccggtggctccaacatttgggcttgggctatcggtgccggtgctctc
ggtgccggcggtctgtggtatctcaaccaggacggcgcttccgctacccccaaggttttc
gctcccaagttcgacgactaccaggccgtgtacaacgagattgcctctcgcctcgaggag
aaggatgactacgacgacggcagctacggcccagtcctcgtccgtctcgcatggcacgcc
agcggcacctatgacaaggagaccggcactggtggctccaacggtgccaccatgcgcttc
gctcctgagtctgaccatggtgccaacgccggcctgaaggctgctcgtgacttcctcgag
cctgtcaaggccaagttcccttggatcacctactccgatctctggatcctcggcggtgtt
tgcgccatccaggagatgcttggcccccagatcccctaccgccccggtcgccaggaccgt
gatgctgctggttgcactcccgatggccgtcttcctgatgcctcccaggcccaggaccat
ctccgcaacatcttctaccgcatgggcttcaacgatcaggagatcgttgctctttccggt
gctcacgctctcggccgctgccacgctgaccgctccggctttgacggtccctggactttc
tcccctaccgttttgaccaacgattactacaagctgctcctcgacgagaagtggcagtgg
aagaagtggaacggccctaagcagtatgaggacaagaagaccaagtccctcatgatgctc
cccgccgatatggccctcatccaggacaagaagttcaagcagtgggtggagaagtacgcc
gccgacaacgagctcttcttcaaggacttctccaatgtcattgtcaagctctttgagctc
ggtgttcctttcgccgagaactccgagcgctgggtcttcaagaccgtcaatgcttag

DBGET integrated database retrieval system