KEGG   Neurospora crassa: NCU03337Help
Entry
NCU03337          CDS       T01034                                 

Definition
(RefSeq) ATP-dependent DNA helicase recQ
  KO
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     NCU03337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Linkage Group II; II
AA seq 483 aa AA seqDB search
MPLLRSDSFKDIDFTLRRQFGKENFRPHQREIIEAALDGHDVFVQAATSFGKSLCFQLPA
VIDRGITIVISPLLSLMMNQVEALKASDVDARTLNSNTTLAERDYIYADLATGHPLMRLL
YVTPELCSGDHFRRKLKLVYEQHELARIVVDEAHCISEWGHDFRKDFKRLSWFRETFPDV
PVMCLTATANEQVRHDVLTTLGLDKTPGKLKIFSMTAHRPNLHLEVRFTSDEANDRYDDF
VTWLKGVYDRRAAVDRKAELDAIGERVENVPGIIYTISRDEVESLAAALRHDGIGARPFH
AKLPNQVKEETLAKWIANDPGYDVIVATTAFGMGIDKENVRFVVHWRLPKSFEGYYQEAG
RAGRDGNASYCFLYYSREDRDRVCNLVMREPVSKNASADGIINKQARQMSLSRLVAYCED
TGCCRHAAICRYFGETQVPACDYACDWHKDPQGLKRRMARGLASEEWVSTQREEGMYDEY
WSE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcctaaggagcgactccttcaaagacattgacttcactcttcgtcgacaattc
ggcaaagaaaactttagaccacatcagagagagatcatcgaggctgccctcgacggtcat
gatgttttcgtccaggcagccacctccttcggcaagagtctatgcttccaactgccagca
gttatagaccgtggaatcaccattgtgatctctccattactgagtctcatgatgaaccaa
gtcgaagccctcaaggcatcagatgtggacgctcgcactttgaacagcaacactaccctg
gcagagcgagactacatctacgctgatctcgcaactgggcatcccctcatgcggctcctc
tatgtgactcccgagctgtgttccggcgaccacttccggcggaaactgaagctggtctac
gaacagcacgagctggcgcgtatcgtggttgacgaagcccattgcatctcagaatggggc
cacgacttccgcaaagacttcaaacggctctcctggttccgcgaaacctttcccgatgta
ccagtcatgtgtctcaccgccacagccaacgagcaagtccgtcacgatgtgcttaccacg
ctagggctggacaagacgcccggcaaactcaagatcttcagcatgacagcccaccgaccg
aacctgcacctcgaagtgcgtttcaccagcgacgaagccaacgaccgctacgacgacttt
gtcacctggctcaagggcgtgtacgaccgtcgagcggccgtggatcgaaaagccgagcta
gacgccatcggcgagcgcgtcgagaacgtaccggggattatctacaccatctctcgcgac
gaagtcgagtcgctcgcggccgccttacgacacgacggtatcggcgcgcggcccttccac
gcaaaactgccgaaccaggtgaaggaggagacgttggccaagtggattgccaacgatccg
gggtacgatgtcatcgtggctacgacggccttcggcatgggaatcgacaaggagaacgtg
cggttcgtcgtacactggcggctgcccaagtcgtttgagggctattaccaagaggccggg
cgggcgggtcgtgatgggaatgcgagttattgttttctttactatagccgcgaagaccgg
gatagggtttgcaacttggtcatgagggagccagtgtcgaaaaacgcgtccgcggatggc
atcattaataaacaggcaaggcagatgagtcttagtaggctggtggcgtattgtgaggat
accggttgttgtcggcatgcggcaatttgcaggtattttggggagacgcaagtgcctgcg
tgcgattacgcgtgtgactggcataaggatccgcagggactgaagaggaggatggcgagg
gggttggcgagtgaggaatgggttagtactcagcgggaagagggcatgtacgatgaatat
tggagtgagtag

DBGET integrated database retrieval system