KEGG   Neurospora crassa: NCU03425Help
Entry
NCU03425          CDS       T01034                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ncr  Neurospora crassa
Pathway
ncr00260  Glycine, serine and threonine metabolism
ncr00750  Vitamin B6 metabolism
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
ncr01230  Biosynthesis of amino acids
Module
ncr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NCU03425
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NCU03425
Enzymes [BR:ncr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NCU03425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 3872858
NCBI-ProteinID: XP_956711
UniProt: Q1K5C3
Position
Linkage Group II; II
AA seq 553 aa AA seqDB search
MSNGVATNGTESQDQTHTPCQRYLSTRGEDGGHSFEYVVLKGLAADGGLYIPQEVPVVPE
SVWQSWKDLSYTDLAYNIISLFVSPSEIPAEDLKDIINRSYATFRTPEVTPLVHLQDSIH
LLELFHGPTFAFKDVALQFLGNLFEYFLVRKNQGKEGRDRYHLTVVGATSGDTGSAAIYG
LRGKKDVSVFMLHPKGRVSPIQELQMTTVLDANVHNLAITGNFDHCQDILKSLFADPEIN
ATHKLGAVNSINWARILAQTVYYFYSYFSLARQSESFNIGDKVRFVVPSGNFGDILAGYF
AFRMGLPVDKLVIATNENDSLDRFWKTGCYTKKPVSGSKAEGGLPEDGAKAHEDGVKETM
SPAMDVLVSSNFERLLWYLAYEFASSAGMDDEWNKKQAGQEVSSWLTDLKVKDGFGPVYK
DVLESARRNFESERVTDQETLDTIKSLYQEVGYVLDPHTAVGVEAARRSVKRAGADIPHI
SLSTAHPAKFSGAVNLALQDQPEFDFEAKVLPQEFVGLDQKEKRVQDVANDWTAVREVIR
EQVEEELKALDSA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacggcgtcgcgaccaacggcactgagtcccaggaccagactcacaccccttgc
caacgctatctgagcacccgcggtgaggacggcggtcactctttcgaatacgtcgtcctc
aagggtctcgccgccgacggcggtctctacatcccccaagaggtgcctgtcgtgcccgag
tccgtatggcagagctggaaggacctatcctataccgacctcgcctacaacatcatctct
ctcttcgtttccccctcagagatccccgccgaagaccttaaagacatcatcaaccgctcc
tacgctaccttccgcacccccgaggttactccccttgtccacctccaggacagcatacat
cttctcgagctcttccacggcccgacttttgccttcaaggatgtcgcccttcagttcctc
ggcaatctcttcgagtacttcctcgtgcgcaagaaccagggcaaggagggaagagacagg
taccacctgactgttgttggcgcgacgagcggtgacactggctccgccgccatctacggt
ttgcgcggcaagaaggatgtctccgttttcatgcttcaccccaagggccgtgtaagcccc
atccaggagcttcagatgaccactgtgctcgatgccaacgttcacaacctcgccatcacc
ggcaacttcgaccattgccaggacatcctcaagtctctcttcgccgaccccgagatcaac
gctacccacaagctcggcgccgtcaactccatcaactgggcccgtatccttgcccagacc
gtgtactacttctactcctacttctccctggcccgccagtccgagtccttcaacattggc
gacaaggtgcgcttcgtcgttccctcgggcaactttggcgacatcctcgccggctacttc
gctttccgcatgggtctccccgtcgacaagctcgtcatcgccaccaatgagaacgacagt
cttgaccgcttctggaagactggctgctacaccaagaagcccgtcagcggctccaaggct
gagggcggtcttcccgaagacggcgccaaggcgcacgaggatggagtcaaggagaccatg
agccccgccatggacgtcctggtatcgagcaactttgagcgtctgttgtggtatctcgcc
tacgagtttgcctccagcgccggtatggatgacgagtggaacaagaagcaggccggtcag
gaggtcagctcctggcttacggatctcaaggtgaaggacggcttcggccccgtctacaag
gacgtccttgagagcgcgcgccgcaactttgagagcgagcgtgtcaccgaccaggagacc
ctcgacaccatcaagagcctgtaccaggaggttggctacgtactggacccccacaccgcc
gtcggtgtcgaggccgccaggagatcggtcaagcgcgccggtgccgacatcccccacatt
tccctatcgacagcccaccccgccaagttctctggcgccgtcaaccttgcgcttcaggac
cagcccgagttcgactttgaggccaaggtgctaccgcaggagtttgtcggtctggaccag
aaggagaagcgcgtccaggatgtggccaatgactggacggcagtgagggaggtgatcagg
gaacaagtagaggaggagttgaaggcgctggattctgcttag

DBGET integrated database retrieval system