KEGG   Neurospora crassa: NCU03528Help
Entry
NCU03528          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
ncr  Neurospora crassa
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ncr00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ncr00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ncr03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ncr03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ncr03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ncr03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ncr03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 241 aa AA seqDB search
MPVTRKSTRSRGGAAAAAQGKQQTLSFHHRVTKPTVKTGKDLVKEEEAPDLNKIKAKDIK
VEEEAIKEPEPSESEEEEEEHEKKEKKKQPHATKVKKPAKKAATKHVKEVHVKEEPKQEE
KKEEEEPKRSEIELCALEIPQSAIDAYWNKIDSARMASTVHKKHTQDLTTGEKVLRYFDV
SSHYGPCIGITRLKRWQRAEKLGLNPPLEVLAVLLKEGEGEDKVKERAHMDELLNSVSTG
P
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgccagtcacacgcaaatcaactcgctctcgtggcggcgccgctgccgctgcccaaggc
aaacagcagaccctctccttccaccaccgcgtcaccaagccgaccgtcaaaacaggcaaa
gacctcgtcaaagaggaggaagcacctgacctaaacaagatcaaggccaaggacatcaag
gtcgaagaggaagccattaaagaacccgagcctagcgagtcggaagaggaggaggaggag
cacgagaagaaagagaagaagaagcagccacatgccaccaaggtgaagaagcccgcaaag
aaagccgcgacgaagcacgtcaaggaggtacacgtcaaggaggaacccaagcaggaggag
aagaaagaagaagaggaaccaaaaagaagcgaaatcgaactctgcgccctggagatcccg
caatctgccattgatgcctattggaacaagatcgactcggcgcgcatggcgtccaccgtg
cacaagaagcatacacaggacttgacgacgggggagaaggtcctgaggtattttgatgtt
agtagtcattatggtccttgcatcggaattactcgtctcaagcgctggcagagggcagag
aaactgggacttaacccccctcttgaagtcttggcggtcttgttgaaggagggagagggt
gaagataaggttaaagagagggcgcatatggatgaattgttgaacagtgtttctactggt
ccttga

DBGET integrated database retrieval system