KEGG   Neurospora crassa: NCU03528Help
Entry
NCU03528          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
ncr  Neurospora crassa
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NCU03528
   00240 Pyrimidine metabolism
    NCU03528
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NCU03528
   03410 Base excision repair
    NCU03528
   03420 Nucleotide excision repair
    NCU03528
   03430 Mismatch repair
    NCU03528
   03440 Homologous recombination
    NCU03528
DNA repair and recombination proteins [BR:ncr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      NCU03528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 241 aa AA seqDB search
MPVTRKSTRSRGGAAAAAQGKQQTLSFHHRVTKPTVKTGKDLVKEEEAPDLNKIKAKDIK
VEEEAIKEPEPSESEEEEEEHEKKEKKKQPHATKVKKPAKKAATKHVKEVHVKEEPKQEE
KKEEEEPKRSEIELCALEIPQSAIDAYWNKIDSARMASTVHKKHTQDLTTGEKVLRYFDV
SSHYGPCIGITRLKRWQRAEKLGLNPPLEVLAVLLKEGEGEDKVKERAHMDELLNSVSTG
P
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgccagtcacacgcaaatcaactcgctctcgtggcggcgccgctgccgctgcccaaggc
aaacagcagaccctctccttccaccaccgcgtcaccaagccgaccgtcaaaacaggcaaa
gacctcgtcaaagaggaggaagcacctgacctaaacaagatcaaggccaaggacatcaag
gtcgaagaggaagccattaaagaacccgagcctagcgagtcggaagaggaggaggaggag
cacgagaagaaagagaagaagaagcagccacatgccaccaaggtgaagaagcccgcaaag
aaagccgcgacgaagcacgtcaaggaggtacacgtcaaggaggaacccaagcaggaggag
aagaaagaagaagaggaaccaaaaagaagcgaaatcgaactctgcgccctggagatcccg
caatctgccattgatgcctattggaacaagatcgactcggcgcgcatggcgtccaccgtg
cacaagaagcatacacaggacttgacgacgggggagaaggtcctgaggtattttgatgtt
agtagtcattatggtccttgcatcggaattactcgtctcaagcgctggcagagggcagag
aaactgggacttaacccccctcttgaagtcttggcggtcttgttgaaggagggagagggt
gaagataaggttaaagagagggcgcatatggatgaattgttgaacagtgtttctactggt
ccttga

DBGET integrated database retrieval system