KEGG   Neurospora crassa: NCU03739Help
Entry
NCU03739          CDS       T01034                                 

Definition
protein disulfide-isomerase tigA precursor
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ncr  Neurospora crassa
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NCU03739
Enzymes [BR:ncr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NCU03739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 369 aa AA seqDB search
MVLLKSLVVASLAAAVAAKSAVLDLIPSNFDDVVLKSGKPTLVEFFAPWCGHCKNLAPVY
EELATALEYAKDKVQIAKVDADAERALGKRFGVQGFPTLKFFDGKSEQPVDYKGGRDLDS
LSNFIAEKTGVKARKKGSAPSLVNILNDATIKGAIGGDKNVLVAFTAPWCGHCKNLAPTW
EKLAATFASDPEITIAKVDADAPTGKKSAAEYGVSGFPTIKFFPKGSTTPEDYNGGRSEA
DLVKFLNEKAGTHRTPGGGLDTVAGTIAALDEIVAKYTGGASLAEVAEEAKEAVKSLKNS
AELKYADYYLRVLDKLSKSEGYATKEFARLEGILKKGGLAPAKVDELTVKVNVLRKFVEK
AAEEAKEEL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggtccttcttaagagcttggtggtagccagcttggctgctgccgtggcggccaagtct
gccgtcctcgaccttatcccctccaacttcgacgatgtcgtcctcaagtccggcaagcca
accctcgtcgagttctttgcgccctggtgcggtcactgcaagaacctcgcccccgtctac
gaggagcttgctaccgctctggagtacgcgaaggacaaggtccagatcgccaaggtcgac
gccgatgctgagagagcgctgggcaagcgttttggtgtccagggcttccccacactcaag
ttctttgatggcaagagcgagcagccggtagactacaagggcggacgtgatttggacagc
ctgtctaacttcattgccgagaagaccggcgtcaaggccaggaagaagggttctgctcca
agcctcgttaacatccttaacgatgccaccatcaagggcgccattggcggcgacaagaac
gtcctggttgctttcactgctccctggtgcggccactgcaagaacctcgctcctacctgg
gagaagctcgccgctaccttcgccagcgacccggagatcaccattgccaaggttgatgcc
gatgcgcctaccggcaaaaagtccgccgccgagtatggcgtttccggtttccccacgatc
aagttcttccccaagggaagcactacccccgaagactacaacggcggccgctccgaggct
gatctcgtcaaattcctgaacgagaaggccggtacccaccgtacccccggtggtggcctt
gataccgttgctggtaccattgctgccctcgatgagattgttgccaagtacaccggcggc
gcctccctggctgaggttgctgaggaggctaaggaggccgtcaagagcctgaagaactct
gccgagctcaagtacgccgactactacctccgcgtcctcgacaagcttagcaagagcgag
ggctatgccactaaggagtttgcccgtctggagggcatcctcaagaagggtggccttgcc
ccggccaaggttgatgagcttaccgtcaaggtcaatgttctccgcaagtttgttgagaag
gcggctgaggaggctaaggaggagctctaa

DBGET integrated database retrieval system