KEGG   Neurospora crassa: NCU03797Help
Entry
NCU03797          CDS       T01034                                 

Definition
similar to ubiquitin C-terminal hydrolase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NCU03797
Peptidases [BR:ncr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NCU03797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 1174 aa AA seqDB search
MGNPANRALLTPSPSPPSDDQVANLPVRTKDDQNPQAPSPNAMLVDTPEEHVVEPNGVDN
DEVAIITPEADEKEAPVLATDYKTMKEHVLPALIDEPPILEDQVYTWEIKGWRNLNKKEH
GPIFHAGGFPWRILLFPYGNNVDQCSIYLEHGFEADEMPEKWSCCVQFALVLWNPNDPSV
FHHHSAHHRFTKEESDWGFTRFLELRRLFSQPYDGSSRPLGENESVNISAYVRIVEDETG
VLWHNFNNYDSKQETGYVGLKNQGATCYLNSLLQSLYFTNAFRKIIYQIPTEQDESMMNS
AYTLQRLFYQLQTSNTAVATSELTKSFGWETRHIFEQQDVQELSRKLMERMEEKMKGTPH
EKALAQMFSGKIKTFISCINVPYESSRVEDFWDVQLNVSGNKNLLESFQDYIQVEKLDGE
NQYYAGDEYKLQDANKGVIFQSFPDVLHLQLKRFEYDIQRDTMMKINARYEFPEEFDAAP
FLEKDADRSEPWEYELHGVLVHSGDLNTGHYYAFLKPTKDGNWYKYDDDKVTKARKLEVL
EDNFGGPFRLPNGQIRTLPQKKTPIMRPNSAYMLVYIRKSRIDQILTQVTEEDTPPHLRN
RFAEELAAREARRKEREEQHLYIGVKVVTEATFQEHGGTDLTYFDTTPDQDPGAPIYYRV
LRQDTMEQLVAKIAADLGQDPKRVRLWIMVNRQNKTVRPDVPIMDLALTVEETYSKATAQ
RDESLRVWAEVAEEVNADGEPIWPSHQAQANGAIVKDNILLFLKWFDVESQTLRGVGHVY
VRLDKKVEDLVPVILKKMGWGEKVPSGEKIQLWEEIKPTMVEPLRGKETLKTEELQDGDI
ICFQRTHVHKSRLGLGESKPSEDAKSSDKLTDAREYYDFLYHRKVFELVLSSKMSYDKLS
EKVGEHIGVEPTHIRFYTINGANGNPRTAVKKLSNQTVERILTPPGYGQMNLNQLSDALY
YEVLDISLAELDTKKSLKVTWLSEGITKEDQYDLLVTKSGVVEDLIETLVKKAKIPGEEE
AGQIRVYEVSNNKWYRDLDRNYPVISINEYTTVVAERKPEEEIGVTDPNQYITVFHFQNE
PSRAHGMSFRFLIKEGEPFSETKKRLEKRLGIKGKSFEKIKFAVVRRAQFSRPIYLQDDD
ILYEKAEKEDYLGLDHVDRSRSARNGGGDLFLKG
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccccgccaaccgcgctcttctgactccctcgccatccccgccatctgacgac
caggttgctaatctgcctgtccgcaccaaggatgaccaaaacccccaagccccctcgccc
aacgccatgttggtcgatacacccgaggaacacgttgtcgaaccaaacggcgtcgataat
gacgaggtcgcaatcatcaccccggaggctgacgagaaggaggctcctgtccttgccact
gactacaaaaccatgaaagagcacgtccttccagccctaatcgacgaacccccaatcctt
gaggaccaggtttacacgtgggagatcaagggttggcgcaacctaaacaagaaggagcat
ggtcccatcttccatgctggtggcttcccatggcgaattcttcttttcccgtatggcaat
aatgttgaccagtgctcgatatacctggaacacggcttcgaagcggacgaaatgcccgaa
aaatggagctgctgcgttcagtttgcgctcgtgctatggaatcctaacgacccttccgtc
tttcatcaccattccgcccatcaccgtttcaccaaggaagagagcgattggggttttaca
cggtttctggaactccggaggctgttcagtcagccttatgacggttcaagccgtcctctc
ggcgaaaatgaaagcgtcaacattagcgcctacgtcaggattgtcgaggatgaaacagga
gttttgtggcacaacttcaacaactacgattcgaagcaggagacaggctacgtcggtctc
aaaaaccagggcgccacttgctatctgaactcactcttacagtcgctctatttcaccaat
gctttccgcaagattatctaccaaattcctaccgaacaagacgagagcatgatgaacagc
gcctatactctacaacgactcttttatcagttgcaaacatcaaatactgccgtggctacc
agtgagcttaccaagtcttttggatgggagacccgtcatatttttgagcagcaagacgtc
caggagctctcgcggaaattgatggaacgcatggaggagaagatgaagggcacaccacac
gagaaagcccttgcacagatgttcagcggcaagatcaaaaccttcatctcctgcatcaac
gttccgtacgaatccagtcgagttgaagatttctgggacgtccaacttaacgttagcggc
aataagaacctgctggagagtttccaggactacatccaggtggaaaaattggacggggaa
aaccagtactatgctggcgacgagtacaaacttcaggatgccaacaagggcgtcattttc
cagagctttcccgatgttctgcatttgcagttgaaacgcttcgaatacgacattcagcgc
gacacgatgatgaagatcaatgctcgctacgagtttcccgaggagttcgatgcagctccc
ttcctcgagaaagacgccgaccgatcggaaccttgggaatacgagcttcatggtgtgctg
gtacacagtggggacctgaacaccggccattattacgctttcctgaagcccaccaaggac
ggaaattggtacaagtacgacgatgacaaagtcaccaaggccaggaagcttgaggtcctg
gaagacaactttggcggtcctttccggttgccgaatggacaaattaggactttacctcaa
aagaagacaccaatcatgcgacccaatagcgcttacatgctcgtgtatattcgcaagtcc
cgaatcgaccagatccttacccaggttaccgaagaggacacacctccacatctccgcaac
agattcgcagaggagctggctgctcgtgaagcccgacgcaaggagagggaggaacaacac
ctctatataggggttaaggtcgtcaccgaagcgacgttccaggagcacggcggcaccgat
ctgacctatttcgacacgactcctgaccaagatcccggggcaccgatttactatcgtgtt
cttcgccaggataccatggagcagttggtcgctaaaattgcagcagacctcggacaagat
cctaaacgggtccggttgtggataatggtgaatcgccagaacaagacagttcgcccggac
gttcctatcatggatcttgcgcttacagtggaggaaacctactccaaggctactgctcaa
cgggatgagtctttacgtgtgtgggcagaagtggctgaggaggtcaacgcggacggtgaa
cccatctggccatcgcatcaggcacaagctaacggcgcgattgtaaaggataacatcttg
ttgttcctaaaatggtttgacgtggagagccaaaccttgaggggcgttgggcatgtctac
gtgaggttggacaagaaggtcgaggatctggtccctgtgattctgaagaagatgggctgg
ggcgaaaaagtccccagtggagagaagattcagctgtgggaggagatcaagccaacgatg
gtggaaccgctacgaggcaaggaaactcttaagaccgaggagttgcaagacggagacatc
atctgcttccagcggacccatgtgcacaagtcaagacttggtcttggcgagagcaagcct
tctgaagacgctaaatcatcggacaagttgacggatgctagggagtattacgacttcttg
taccaccgcaaggtcttcgagcttgtcttgagttccaagatgagctatgacaaactttcg
gagaaggttggagagcacataggtgtcgagcctactcacattcggttctataccatcaat
ggggcaaatggcaatcccaggacggcagtcaagaagctatccaaccaaacggtagagagg
attcttaccccgccgggatacgggcagatgaacctcaatcaactatcagacgcactttac
tacgaagttctcgacattagtcttgccgagctagacaccaagaagagcctcaaggtcact
tggctcagcgagggcatcacaaaagaggaccaatacgatcttcttgtaacgaagagtggt
gtggttgaggacctgatcgagacgttggtcaagaaggccaagattcctggcgaggaggag
gccggccaaatccgggtatatgaagtcagcaacaacaagtggtacagagatctcgacaga
aactatcctgttatctctattaacgagtacaccaccgttgtggctgaacggaaacccgag
gaggagattggtgtcactgatcctaaccagtatataaccgtcttccacttccaaaacgaa
ccgagcagggctcacggcatgtcgttcagattcttgatcaaagagggcgagccattttcg
gagacgaagaagcggctcgaaaagagattgggaatcaagggcaagagcttcgagaagatc
aagttcgctgtggttaggagggctcagttctcacgacccatctatctccaagacgacgac
atcctgtacgagaaggccgaaaaagaggactaccttggcctggaccacgttgatcggtca
aggtcggcgcgaaatggcggtggtgacttgttcctcaagggataa

DBGET integrated database retrieval system