KEGG   Neurospora crassa: NCU03801Help
Entry
NCU03801          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ncr  Neurospora crassa
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NCU03801
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NCU03801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 626 aa AA seqDB search
MAISQTRAAAISSIGIRALSYFFLRWAMLPFGPALIFTLFAIYLPTFVSGYRKEPKYNLV
DEVDVVVTETTIRDDNAETDDSPGEPAPNGHEKVVAEQVDIQEIISIEKRPMHALRTLLS
GAPNPRSLALSALTFLINAALVGFVADRLFRERYYGAEDLSFARVGYVGEHEAKLLIREP
DQTKMPINIQIHLKDPQPPFDNPLWQSVGGVRWTGNETDYTAVVTIPLRNSGRRTYEWKT
SNNHTGEFTTPPKVGEGPLTFLSTSCIVSRLPYNPADHPLAIPGMRHLAKVLPSLGAQFM
LFLGDFIYIDVPRYWAKSTEEYRKKYRQVYASPDWPAVGQNLSWIHVLDDHEIQNDWSAN
TTGVYQNAIDPYNHYHAAANPPLAKKAGALSARSGATYFEFTQGPASFFLLDTRTYRSNN
KVAFTDDSKTMLGAEQLEDFIAWLRRPEPKGVKWKIVASSVPFTKNWGVNTQDTWGGFLT
ERKRILEVMWDTASRGVGVVVLSGDRHEFAATKFPPPMNSTWPESATVFEFSASPLSQFY
SPIGTYRQRDTEDVEIKYINKGNSKFGAITIENLEGGEQSDLKYRLFIDGEEVWNTVILS
PPVVIEDVKPAIAAGSWWERFFAWRR
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggcgatatcacaaacgcgagcagcggccatatcgtccatcgggataagggccctcagt
tacttcttcctacgatgggcaatgcttccgtttggtcctgcgctcatcttcacactcttc
gccatctatctgcctactttcgtgtctggctaccgcaaggagcccaagtacaacttggtt
gatgaagtcgatgtggttgttaccgagacaaccatcagggacgacaatgctgagacggac
gacagtcctggagagcctgctcctaacggccacgaaaaggtggtcgccgagcaggttgac
attcaggagatcatctcgatcgagaagcgacccatgcacgctttgcggactctcctcagc
ggcgcacccaacccgcggagcctggccctgtccgcattgaccttcttgatcaacgctgcg
ttggttggcttcgtcgctgatcgattgttccgcgagcgttactacggtgctgaagacctt
tcctttgcccgcgttggctatgtcggcgaacacgaagctaagctcttgatccgtgagccg
gatcagaccaagatgcccatcaacatacagattcatctcaaggacccccagcctcctttt
gacaaccctctgtggcaatcagttggcggtgtcagatggaccggaaacgagaccgattac
actgctgttgttacgattcccctccgcaactcgggacggcgaacttacgaatggaagacc
tcgaacaaccacaccggagagttcaccactccgcccaaggttggcgagggccctctcact
ttcctctcaacatcctgcatcgtgagccgcttgccctacaatccggcggatcacccattg
gctattcccggtatgcgacacttggccaaggtcctccccagcttgggcgcgcagttcatg
cttttccttggagacttcatctacatcgatgttccgcgctactgggccaagagcaccgag
gaataccgcaagaagtatcgtcaggtctacgcttctccagactggccagctgttggccag
aacctcagctggatacacgtgctcgacgatcacgaaattcagaacgactggtctgccaac
accaccggcgtataccagaacgccatcgacccttacaaccactaccacgcagctgccaac
cctccgctagccaagaaggctggtgccctcagcgctcgcagcggagccacatactttgag
tttacccagggtcctgctagcttcttcctgcttgacactcgcacctaccgctcgaacaac
aaggttgcctttaccgacgattccaagactatgctaggcgccgaacaactcgaagacttc
attgcctggctcaggcgcccggagccgaagggcgtcaagtggaagattgtcgcttcatcg
gttcccttcaccaagaactggggcgtcaacacgcaggatacctggggcggcttcttgacc
gagaggaaacggattctggaggtcatgtgggatactgcgagcaggggcgttggtgtagtt
gttctgtctggtgatagacacgagtttgcggctaccaagttcccgccgccgatgaacagc
acatggcctgaaagcgctacggtgtttgagttctctgctagcccattgagccaattctac
tcgcctattggcacgtatagacaaagagatactgaggatgttgagatcaagtacatcaac
aagggcaactccaagttcggtgctatcaccatcgagaacctcgagggaggtgaacagagc
gacttaaagtaccgcctgtttattgatggtgaggaggtctggaacaccgtaatcttgtcc
ccaccggtcgtcattgaagatgtcaagcctgctatcgcagctgggtcgtggtgggagcgg
ttcttcgcttggagaagataa

DBGET integrated database retrieval system