KEGG   Neurospora crassa: NCU03833Help
Entry
NCU03833          CDS       T01034                                 

Gene name
cnb-1
Definition
(RefSeq) calcineurin B-1
  KO
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ncr  Neurospora crassa
Brite
Protein phosphatases and associated proteins [BR:ncr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     NCU03833 (cnb-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Linkage Group V; V
AA seq 174 aa AA seqDB search
MGNTTSSVLDNIVQGSNFDREEVDRLRKRFMKLDKDNSGTIEREEFLSLPQISTNPLATR
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEQKLRFAFKVYDIDRDGYISNGELFIVLK
MMVGSNLKDQQLQQIVDKTIMEADLDKDGKISFEEFTKMVENTDVSMSMTLDQF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaccaccagctccgtcctggacaacattgtccagggatccaacttcgacagg
gaagaggttgaccgcttgcgtaagaggtttatgaagttggacaaggataattccggtacc
atcgagcgcgaagagttcttgagcctaccgcaaatatcgacaaatcctctggctacaaga
atgattgccatcttcgacgaagacggtggtggcgacgtcgactttcaagagttcgtatcc
ggcttaagcgccttctcgagcaaaggcaacaaggagcagaagctgcggttcgctttcaag
gtgtacgacattgaccgtgacgggtacatcagcaacggcgagttgtttatcgtactgaag
atgatggtaggcagcaaccttaaggaccaacagctgcaacagattgtcgacaagacgatc
atggaggcggatttggacaaggacggcaagatcagctttgaggagttcaccaagatggtg
gagaacacggatgtcagcatgagcatgactttggatcaattctag

DBGET integrated database retrieval system