KEGG   Neurospora crassa: NCU04014Help
Entry
NCU04014          CDS       T01034                                 

Definition
(RefSeq) hypothetical protein
  KO
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
ncr  Neurospora crassa
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NCU04014
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NCU04014
Peptidases [BR:ncr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NCU04014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
VI
AA seq 1110 aa AA seqDB search
MVNHATPAHSVNGQNGHITGGWDGTQDGGQNRTINGGGGGGGGGYGPGTGGSKRPPMPHL
DDLKAVTVSIDPATPIDSALRLAEEALQQAKAFQSFGRIDMAFRSYIKANIIALDIIPKN
KDWALLDRSRPNVYMRHQHLLRQIKSLLSDFDKIKEQIKQDNARTGVQPLLGSPNQQKTS
SVGVGHGHTRSHSNFSSNTTSPDSSVYSSPRQSTYALPDQSWPSPGRSKPAVHPKPQALH
GHALQHSGGPATTPTNNAAQDLALRFAKLRAYTASTPSPANTTTTIQDPRIRTQPIPQPI
MPINPPAPRDPPRSQVPSVPPATALADLPRVPAAIYNPPRGTVSNEAAELPSSAPRAMFT
RKGSTASATGMNRNGRPRTSDEGLVSGPPVTSPKMRPKPAIPDGDTISAEELERYMRVGA
RDVSILVVDIRSRDEYDEGHVMSQATICVENEVLMRPDISASDIAESMVLAPQAEQQRFE
RRHDFDLIVFYDQRSKRLVSSPQTPEERAVLTFYNALTAYDYAGGSSSQQRLKLLKGGIE
AWTDLVGTGALQTSSTSAAARSQPRPPLTHNLTSRLRRNVTRPIQDLAEVQKWEENVDIV
TPVRTTEDFLRRYPSVSTIQESMTSPINPAAARPASPLPRHIVHEQNLYSSLPSPPTRPA
PTVPRRSYSGLAETDTSTTATSTRSSLKSGIEKVRKFRTGLVNPGVFCFANSSLQAMFAT
PGFARELYTGVWKDVYKVPLKADEKNENPQLLTKYLAGLFHWLDEGTLRSLEAKHLMAYI
HFIHSKNADGRKKPETEIFGGPAQQDAQEFYSFIIDNIHDETNVHRDRKPPKEEKPYTPK
NGTVIQNAIDYWRDYSNASASIIDKYFRGLEVFISRCQNAECRQEIRMFQPCDVWILNIA
AETGGEGNGYGVTDLDRLLASHQATEHFPDLKCETCNQPGRTRRAKFARLPDRLAFCLNR
FNSSFGQSRNSFSSILSGGGSNKIHTKVRFPIRDLDLTKYCAEPDPDMATTDDAHYAGRM
KYDCYAVTVHVGQGINGGHYYTYVQDEQSKDPTDWFKCNDDLVERVKIGSGGPGLNGNGN
GNGGMPDLTEAMYANGNTSAYMVYYRRQGT
NT seq 3333 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaccatgcaacacctgcgcattccgtcaacgggcagaatggccacataacagga
ggttgggacggcacacaagatggtggacagaaccggacaatcaacggagggggaggggga
ggagggggaggatatgggccagggaccggaggaagcaaacgaccaccaatgccgcatctg
gacgacctcaaggctgttacagtcagcatagaccccgcgaccccgatcgacagtgctctc
aggctcgccgaagaagcactccagcaagccaaagccttccagtcctttggtaggattgac
atggccttcaggtcatacatcaaggccaacattatagctctggatatcatcccgaagaat
aaggactgggcgctgctggatcgaagccgaccgaacgtatatatgcgacatcaacatctg
ctccgacagatcaagagcctgttaagcgacttcgacaagatcaaagagcagatcaaacaa
gataatgcccgaacgggtgtccagccactactaggaagcccaaatcaacaaaaaacgtcc
agtgtcggggtcggacacggacatacgagatcacattccaacttctcgtcaaataccacg
agtcccgacagttcggtctatagctcgccccgacaaagtacgtatgctttgccagatcag
tcatggccgtcgcccgggaggtccaagccagccgtacaccccaaacctcaggctctccac
ggtcatgcgcttcaacactccggcggtccggcgacaactcctaccaacaatgcagctcag
gacctcgctcttcgcttcgcaaagcttcgagcatacaccgccagtaccccgagtcctgcc
aacacaacaacaacaatacaggatcctcgaattcggacacagcccattccgcagcccata
atgccaataaacccaccggcaccgcgtgaccccccgaggtcacaagtaccgagtgttcct
cctgctaccgctctagcggatttacctcgcgtaccagctgctatctacaacccgccacga
ggtacagtgtccaatgaggcagccgagcttccatctagcgctcctcgtgccatgtttacc
agaaagggctcaacggcatcagccactggcatgaataggaatggcagaccccgtacgtcc
gatgaaggtcttgtttctggaccacctgttacaagtccaaagatgagaccaaagcctgct
atacccgatggtgatactatctcggccgaggagcttgagcgctacatgagagttggcgct
agggacgtgtcgattctcgtcgttgacatcagaagtcgtgacgagtacgatgagggccat
gtcatgtcacaggcaacaatatgtgtcgaaaatgaagtgctgatgaggccagatatttct
gccagcgatatagcagagagcatggtattggcaccgcaagccgaacagcagcgttttgag
agacggcatgattttgacctgattgttttctacgaccagcggtccaaacgccttgtatcg
agtccccagacaccagaggaacgagcggtcctaactttttacaatgcccttacagcgtat
gactacgccggcggatcaagttcacaacagcgactgaagttgcttaaaggtggaatagag
gcgtggaccgacctagttgggaccggagctttgcagacatcttccacgagtgccgctgcg
agatcacagccaaggccacctttgacccacaacctcacaagtcgtctacgcagaaacgta
acgcggccaatacaagatctcgcggaggtacaaaaatgggaagaaaacgtcgatattgtt
actccggtgagaactacggaagactttttgcggagatacccttccgtttcaacgatacag
gagtccatgacttcacctatcaaccctgctgccgctcggccagcgagcccattacctcga
catatcgtacacgaacagaacctttactcttcgctaccatctcctccaactcgcccggct
ccgactgtcccacgtaggagttatagcggcctagcagaaaccgacaccagcaccacggca
acgtcaacaagatcgtcacttaaatcgggaattgagaaagtccgcaagtttaggactggt
cttgtcaaccctggtgtattctgcttcgccaacagctctctgcaagccatgttcgccacg
cctggatttgctcgcgagttgtacacgggtgtttggaaggatgtgtacaaagtcccactg
aaagcggatgagaaaaacgaaaatcctcaattactcaccaagtatttagctggcctattc
cactggcttgatgagggaacgctgagatcgttggaagcgaagcatctcatggcttatata
cactttattcactccaagaacgcggatggcaggaagaaaccagaaacggaaatctttggc
gggccggcgcagcaagatgcccaggagttctactcatttatcattgacaacatccatgac
gaaaccaacgttcaccgagaccgcaagccgcccaaagaagaaaagccgtatacacccaag
aacgggacagtgatccagaatgccattgattattggcgtgactattcaaacgccagtgct
tctatcattgacaagtacttccggggcctagaagtcttcatctcccgctgccagaacgcc
gaatgccggcaagaaatccgcatgttccagccctgcgacgtctggatcctcaacatcgcc
gccgagacaggaggcgaaggcaatggctacggagtcacggatcttgaccgtcttcttgcc
agccaccaagcaaccgaacacttcccggacctgaagtgcgaaacatgcaaccaacccggc
aggacaagacgggccaagtttgctcgcctccctgaccgtcttgccttttgtctcaaccgg
ttcaactcgtcctttgggcagtcccgaaattcgttctcctccatcctttctggcggtggt
tccaacaagatccacaccaaagttcggttcccgatccgtgacctcgatctgaccaagtac
tgcgccgaaccggatccggacatggcaactacggacgatgcgcactacgccggccgcatg
aagtatgattgctacgccgtcacggtacatgtgggacagggaatcaatggcgggcattac
tatacgtacgtgcaggatgagcagtccaaggacccgacggattggttcaagtgtaatgat
gatttggtggagagggtgaagattggaagtggtggtccgggtctgaatgggaatggaaat
ggaaatggcggaatgccggacttgacggaggcgatgtatgcaaatgggaacacatcggct
tatatggtgtattatcggcggcagggtacttga

DBGET integrated database retrieval system