KEGG   Neurospora crassa: NCU04014Help
Entry
NCU04014          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
ncr  Neurospora crassa
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NCU04014
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NCU04014
Peptidases [BR:ncr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NCU04014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 1110 aa AA seqDB search
MVNHATPAHSVNGQNGHITGGWDGTQDGGQNRTINGGGGGGGGGYGPGTGGSKRPPMPHL
DDLKAVTVSIDPATPIDSALRLAEEALQQAKAFQSFGRIDMAFRSYIKANIIALDIIPKN
KDWALLDRSRPNVYMRHQHLLRQIKSLLSDFDKIKEQIKQDNARTGVQPLLGSPNQQKTS
SVGVGHGHTRSHSNFSSNTTSPDSSVYSSPRQSTYALPDQSWPSPGRSKPAVHPKPQALH
GHALQHSGGPATTPTNNAAQDLALRFAKLRAYTASTPSPANTTTTIQDPRIRTQPIPQPI
MPINPPAPRDPPRSQVPSVPPATALADLPRVPAAIYNPPRGTVSNEAAELPSSAPRAMFT
RKGSTASATGMNRNGRPRTSDEGLVSGPPVTSPKMRPKPAIPDGDTISAEELERYMRVGA
RDVSILVVDIRSRDEYDEGHVMSQATICVENEVLMRPDISASDIAESMVLAPQAEQQRFE
RRHDFDLIVFYDQRSKRLVSSPQTPEERAVLTFYNALTAYDYAGGSSSQQRLKLLKGGIE
AWTDLVGTGALQTSSTSAAARSQPRPPLTHNLTSRLRRNVTRPIQDLAEVQKWEENVDIV
TPVRTTEDFLRRYPSVSTIQESMTSPINPAAARPASPLPRHIVHEQNLYSSLPSPPTRPA
PTVPRRSYSGLAETDTSTTATSTRSSLKSGIEKVRKFRTGLVNPGVFCFANSSLQAMFAT
PGFARELYTGVWKDVYKVPLKADEKNENPQLLTKYLAGLFHWLDEGTLRSLEAKHLMAYI
HFIHSKNADGRKKPETEIFGGPAQQDAQEFYSFIIDNIHDETNVHRDRKPPKEEKPYTPK
NGTVIQNAIDYWRDYSNASASIIDKYFRGLEVFISRCQNAECRQEIRMFQPCDVWILNIA
AETGGEGNGYGVTDLDRLLASHQATEHFPDLKCETCNQPGRTRRAKFARLPDRLAFCLNR
FNSSFGQSRNSFSSILSGGGSNKIHTKVRFPIRDLDLTKYCAEPDPDMATTDDAHYAGRM
KYDCYAVTVHVGQGINGGHYYTYVQDEQSKDPTDWFKCNDDLVERVKIGSGGPGLNGNGN
GNGGMPDLTEAMYANGNTSAYMVYYRRQGT
NT seq 3333 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaccatgcaacacctgcgcattccgtcaacgggcagaatggccacataacagga
ggttgggacggcacacaagatggtggacagaaccggacaatcaacggagggggaggggga
ggagggggaggatatgggccagggaccggaggaagcaaacgaccaccaatgccgcatctg
gacgacctcaaggctgttacagtcagcatagaccccgcgaccccgatcgacagtgctctc
aggctcgccgaagaagcactccagcaagccaaagccttccagtcctttggtaggattgac
atggccttcaggtcatacatcaaggccaacattatagctctggatatcatcccgaagaat
aaggactgggcgctgctggatcgaagccgaccgaacgtatatatgcgacatcaacatctg
ctccgacagatcaagagcctgttaagcgacttcgacaagatcaaagagcagatcaaacaa
gataatgcccgaacgggtgtccagccactactaggaagcccaaatcaacaaaaaacgtcc
agtgtcggggtcggacacggacatacgagatcacattccaacttctcgtcaaataccacg
agtcccgacagttcggtctatagctcgccccgacaaagtacgtatgctttgccagatcag
tcatggccgtcgcccgggaggtccaagccagccgtacaccccaaacctcaggctctccac
ggtcatgcgcttcaacactccggcggtccggcgacaactcctaccaacaatgcagctcag
gacctcgctcttcgcttcgcaaagcttcgagcatacaccgccagtaccccgagtcctgcc
aacacaacaacaacaatacaggatcctcgaattcggacacagcccattccgcagcccata
atgccaataaacccaccggcaccgcgtgaccccccgaggtcacaagtaccgagtgttcct
cctgctaccgctctagcggatttacctcgcgtaccagctgctatctacaacccgccacga
ggtacagtgtccaatgaggcagccgagcttccatctagcgctcctcgtgccatgtttacc
agaaagggctcaacggcatcagccactggcatgaataggaatggcagaccccgtacgtcc
gatgaaggtcttgtttctggaccacctgttacaagtccaaagatgagaccaaagcctgct
atacccgatggtgatactatctcggccgaggagcttgagcgctacatgagagttggcgct
agggacgtgtcgattctcgtcgttgacatcagaagtcgtgacgagtacgatgagggccat
gtcatgtcacaggcaacaatatgtgtcgaaaatgaagtgctgatgaggccagatatttct
gccagcgatatagcagagagcatggtattggcaccgcaagccgaacagcagcgttttgag
agacggcatgattttgacctgattgttttctacgaccagcggtccaaacgccttgtatcg
agtccccagacaccagaggaacgagcggtcctaactttttacaatgcccttacagcgtat
gactacgccggcggatcaagttcacaacagcgactgaagttgcttaaaggtggaatagag
gcgtggaccgacctagttgggaccggagctttgcagacatcttccacgagtgccgctgcg
agatcacagccaaggccacctttgacccacaacctcacaagtcgtctacgcagaaacgta
acgcggccaatacaagatctcgcggaggtacaaaaatgggaagaaaacgtcgatattgtt
actccggtgagaactacggaagactttttgcggagatacccttccgtttcaacgatacag
gagtccatgacttcacctatcaaccctgctgccgctcggccagcgagcccattacctcga
catatcgtacacgaacagaacctttactcttcgctaccatctcctccaactcgcccggct
ccgactgtcccacgtaggagttatagcggcctagcagaaaccgacaccagcaccacggca
acgtcaacaagatcgtcacttaaatcgggaattgagaaagtccgcaagtttaggactggt
cttgtcaaccctggtgtattctgcttcgccaacagctctctgcaagccatgttcgccacg
cctggatttgctcgcgagttgtacacgggtgtttggaaggatgtgtacaaagtcccactg
aaagcggatgagaaaaacgaaaatcctcaattactcaccaagtatttagctggcctattc
cactggcttgatgagggaacgctgagatcgttggaagcgaagcatctcatggcttatata
cactttattcactccaagaacgcggatggcaggaagaaaccagaaacggaaatctttggc
gggccggcgcagcaagatgcccaggagttctactcatttatcattgacaacatccatgac
gaaaccaacgttcaccgagaccgcaagccgcccaaagaagaaaagccgtatacacccaag
aacgggacagtgatccagaatgccattgattattggcgtgactattcaaacgccagtgct
tctatcattgacaagtacttccggggcctagaagtcttcatctcccgctgccagaacgcc
gaatgccggcaagaaatccgcatgttccagccctgcgacgtctggatcctcaacatcgcc
gccgagacaggaggcgaaggcaatggctacggagtcacggatcttgaccgtcttcttgcc
agccaccaagcaaccgaacacttcccggacctgaagtgcgaaacatgcaaccaacccggc
aggacaagacgggccaagtttgctcgcctccctgaccgtcttgccttttgtctcaaccgg
ttcaactcgtcctttgggcagtcccgaaattcgttctcctccatcctttctggcggtggt
tccaacaagatccacaccaaagttcggttcccgatccgtgacctcgatctgaccaagtac
tgcgccgaaccggatccggacatggcaactacggacgatgcgcactacgccggccgcatg
aagtatgattgctacgccgtcacggtacatgtgggacagggaatcaatggcgggcattac
tatacgtacgtgcaggatgagcagtccaaggacccgacggattggttcaagtgtaatgat
gatttggtggagagggtgaagattggaagtggtggtccgggtctgaatgggaatggaaat
ggaaatggcggaatgccggacttgacggaggcgatgtatgcaaatgggaacacatcggct
tatatggtgtattatcggcggcagggtacttga

DBGET integrated database retrieval system