KEGG   Neurospora crassa: NCU04069Help
Entry
NCU04069          CDS       T01034                                 

Definition
similar to 3'(2',5')-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ncr  Neurospora crassa
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NCU04069
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     NCU04069
Transfer RNA biogenesis [BR:ncr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    NCU04069
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 355 aa AA seqDB search
MASSQYAKELEVAQLAVQRAARLTKRVFHEKAKGTVSKDDKSPVTIGDFGAQALIISALK
ANFPSDEIVAEEEAAQLREDTPLRDQIWELVKSTKLDDEAAEQLLGGAIKDADAMLEIID
QGNSKGGAKGRIWTIDPIDGTKGFLRGGQYAVCLGLMVDGDVKVGVLGCPNLPVDDAAPL
AADIGTNATDEGRGVIFSAVQGQGATSRPLGTAGLAEGKSIAMKPITEMSNASFCESVEA
GHSDQGVAGQIAQKLGITKPSVRMDSQAKYGSIARGAGDIYLRLPTSKSYQEKIWDHAAG
DLIVREAGGQVTDVSGNRLDFSVGRTLAENKGVIAAPAAVHDQVIKVVQEVLGQQ
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttcccagtacgcaaaggagctcgaggtagctcagctcgccgtccagcgggcc
gcccgcctcaccaagcgcgtcttccacgagaaggccaagggcaccgtttccaaggacgac
aagtcccctgtgaccattggcgactttggcgctcaggcgctcatcatcagcgccctcaag
gccaactttccttcggacgagattgtggctgaggaggaggccgctcagctgcgcgaggac
acccccctgcgggaccagatctgggagctcgtcaagtccaccaagcttgacgatgaggct
gccgagcaactccttggcggcgccatcaaggatgccgacgcgatgctggagatcatcgac
cagggcaacagcaagggcggcgccaagggcaggatatggactatcgaccccatcgacggc
accaagggcttcctgcgcggtggacagtatgccgtgtgcttgggactgatggtggacggt
gacgtcaaggtcggtgttctcggttgcccgaacctgcctgtggacgacgctgcgccgttg
gctgcggatatcggcaccaatgcgaccgatgagggccggggtgtcatcttctcggccgtt
cagggccaaggcgcgactagcagacccctgggcaccgccggtcttgcggagggcaagtcc
attgcgatgaagcctattacagagatgtccaacgccagcttctgcgagagcgtggaggcg
ggtcactcggatcagggcgtggctggacagattgcgcagaagctcgggatcaccaagcct
agtgtgcgcatggattcccaggccaagtacggctctattgctcgcggcgcgggtgatatc
tacctccgtctgcctacttccaagtcttaccaggagaagatctgggatcacgctgctgga
gatctgattgtgcgtgaggctggtggtcaggttaccgacgtgagtggaaaccgcctggat
ttcagcgtcggccgcacgttggctgaaaacaagggtgtcattgcggcgcctgctgcggtc
cacgaccaggtcatcaaggtcgttcaggaagttctcgggcagcagtaa

DBGET integrated database retrieval system